General Information of the Molecule (ID: Mol00751)
Name
23S ribosomal RNA methyltransferase Erm (ERM39) ,Mycobacterium fortuitum
Synonyms
erm(39); 23S ribosomal RNA methyltransferase Erm
    Click to Show/Hide
Molecule Type
Protein
Gene Name
erm(39)
Sequence
MSSAHHGRHENGQNFLRDRRVVGDIIRMVSHTTGPIVEIGAGDGALTLPLQRLGRPLTAI
EIDLHRARRLADRTTAEVVATDFLRYRLPRTPHVVVGNLPFHLTTAILRRLLHENGWTDA
TLLVQWEVARRRAGVGGATMMTAQWWPWFEFGLARKVSADAFRPRPSVDAGLLTIQRRAE
PLLPWADHRAYQALVHRVFTGRGRGLAQILRPHVHPRWLSTNGIHPSALPRALTAQQWVA
LFEAAG
    Click to Show/Hide
Uniprot ID
A0A481WX14_MYCFO
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Actinobacteria
Class: Actinomycetia
Order: Corynebacteriales
Family: Mycobacteriaceae
Genus: Mycolicibacterium
Species: Mycolicibacterium fortuitum
Type(s) of Resistant Mechanism of This Molecule
  ADTT: Aberration of the Drug's Therapeutic Target
Drug Resistance Data Categorized by Drug
Approved Drug(s)
5 drug(s) in total
Click to Show/Hide the Full List of Drugs
Clarithromycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Mycobacterium fortuitum infection [1]
Resistant Disease Mycobacterium fortuitum infection [ICD-11: 1B2Z.2]
Resistant Drug Clarithromycin
Molecule Alteration Missense mutation
Putative initiation codon GTG>CTG
Experimental Note Identified from the Human Clinical Data
In Vitro Model Mycobacterium peregrinum ATCC14467 43304
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
Mueller-Hinton (MH) broth assay
Mechanism Description The erm genes are a diverse collection of methylases that add one or two methyl groups to the adenine at position 2058 (Escherichia coli numbering) of the 23S rRNA; this modification impairs the binding of macrolides to ribosomes, and thus reduces the inhibitory activity of these agents.
Clindamycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Mycobacterium fortuitum infection [1]
Resistant Disease Mycobacterium fortuitum infection [ICD-11: 1B2Z.2]
Resistant Drug Clindamycin
Molecule Alteration Missense mutation
Putative initiation codon GTG>CTG
Experimental Note Identified from the Human Clinical Data
In Vitro Model Mycobacterium peregrinum ATCC14467 43304
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
Mueller-Hinton (MH) broth assay
Mechanism Description The erm genes are a diverse collection of methylases that add one or two methyl groups to the adenine at position 2058 (Escherichia coli numbering) of the 23S rRNA; this modification impairs the binding of macrolides to ribosomes, and thus reduces the inhibitory activity of these agents.
Erythromycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Mycobacterium fortuitum infection [1]
Resistant Disease Mycobacterium fortuitum infection [ICD-11: 1B2Z.2]
Resistant Drug Erythromycin
Molecule Alteration Missense mutation
Putative initiation codon GTG>CTG
Experimental Note Identified from the Human Clinical Data
In Vitro Model Mycobacterium peregrinum ATCC14467 43304
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
Mueller-Hinton (MH) broth assay
Mechanism Description The erm genes are a diverse collection of methylases that add one or two methyl groups to the adenine at position 2058 (Escherichia coli numbering) of the 23S rRNA; this modification impairs the binding of macrolides to ribosomes, and thus reduces the inhibitory activity of these agents.
Quinupristin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Mycobacterium fortuitum infection [1]
Resistant Disease Mycobacterium fortuitum infection [ICD-11: 1B2Z.2]
Resistant Drug Quinupristin
Molecule Alteration Missense mutation
Putative initiation codon GTG>CTG
Experimental Note Identified from the Human Clinical Data
In Vitro Model Mycobacterium peregrinum ATCC14467 43304
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
Mueller-Hinton (MH) broth assay
Mechanism Description The erm genes are a diverse collection of methylases that add one or two methyl groups to the adenine at position 2058 (Escherichia coli numbering) of the 23S rRNA; this modification impairs the binding of macrolides to ribosomes, and thus reduces the inhibitory activity of these agents.
Spiramycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Mycobacterium fortuitum infection [1]
Resistant Disease Mycobacterium fortuitum infection [ICD-11: 1B2Z.2]
Resistant Drug Spiramycin
Molecule Alteration Missense mutation
Putative initiation codon GTG>CTG
Experimental Note Identified from the Human Clinical Data
In Vitro Model Mycobacterium peregrinum ATCC14467 43304
Experiment for
Molecule Alteration
DNA sequencing assay
Experiment for
Drug Resistance
Mueller-Hinton (MH) broth assay
Mechanism Description The erm genes are a diverse collection of methylases that add one or two methyl groups to the adenine at position 2058 (Escherichia coli numbering) of the 23S rRNA; this modification impairs the binding of macrolides to ribosomes, and thus reduces the inhibitory activity of these agents.
References
Ref 1 Molecular basis of intrinsic macrolide resistance in clinical isolates of Mycobacterium fortuitum. J Antimicrob Chemother. 2005 Feb;55(2):170-7. doi: 10.1093/jac/dkh523. Epub 2004 Dec 8.
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.