Molecule Information

General Information of the Molecule (ID: Mol00751)

• Name: 23S ribosomal RNA methyltransferase Erm (ERM39) ,Mycobacterium fortuitum
• Synonyms: erm(39); 23S ribosomal RNA methyltransferase Erm
• Molecule Type: Protein
• Gene Name: erm(39)
• Sequence:
  MSSAHHGRHENGQNFLRDRRVVGDIIRMVSHTTGPIVEIGAGDGALTLPLQRLGRPLTAI
  EIDLHRARRLADRTTAEVVATDFLRYRLPRTPHVVVGNLPFHLTTAILRRLLHENGWTDA
  TLLVQWEVARRRAGVGGATMMTAQWWPWFEFGLARKVSADAFRPRPSVDAGLLTIQRRAE
  PLLPWADHRAYQALVHRVFTGRGRGLAQILRPHVHPRWLSTNGIHPSALPRALTAQQWVA
  LFEAAG
• Uniprot ID: A0A481WX14_MYCFO

Kingdom: N.A.
Phylum: Actinobacteria
Class: Actinomycetia
Order: Corynebacteriales
Family: Mycobacteriaceae
Genus: Mycolicibacterium
Species: Mycolicibacterium fortuitum

Type(s) of Resistant Mechanism of This Molecule

  ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s) 5 drug(s) in total

Clarithromycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Mycobacterium fortuitum infection [1]

• Resistant Disease: Mycobacterium fortuitum infection [ICD-11: 1B2Z.2]
• Resistant Drug: Clarithromycin
• Molecule Alteration: Missense mutation; Putative initiation codon GTG>CTG
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Mycobacterium peregrinum ATCC14467; 43304
• Experiment for Molecule Alteration: DNA sequencing assay
• Experiment for Drug Resistance: Mueller-Hinton (MH) broth assay
• Mechanism Description: The erm genes are a diverse collection of methylases that add one or two methyl groups to the adenine at position 2058 (Escherichia coli numbering) of the 23S rRNA; this modification impairs the binding of macrolides to ribosomes, and thus reduces the inhibitory activity of these agents.

Clindamycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Mycobacterium fortuitum infection [1]

• Resistant Disease: Mycobacterium fortuitum infection [ICD-11: 1B2Z.2]
• Resistant Drug: Clindamycin
• Molecule Alteration: Missense mutation; Putative initiation codon GTG>CTG
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Mycobacterium peregrinum ATCC14467; 43304
• Experiment for Molecule Alteration: DNA sequencing assay
• Experiment for Drug Resistance: Mueller-Hinton (MH) broth assay
• Mechanism Description: The erm genes are a diverse collection of methylases that add one or two methyl groups to the adenine at position 2058 (Escherichia coli numbering) of the 23S rRNA; this modification impairs the binding of macrolides to ribosomes, and thus reduces the inhibitory activity of these agents.

Erythromycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Mycobacterium fortuitum infection [1]

• Resistant Disease: Mycobacterium fortuitum infection [ICD-11: 1B2Z.2]
• Resistant Drug: Erythromycin
• Molecule Alteration: Missense mutation; Putative initiation codon GTG>CTG
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Mycobacterium peregrinum ATCC14467; 43304
• Experiment for Molecule Alteration: DNA sequencing assay
• Experiment for Drug Resistance: Mueller-Hinton (MH) broth assay
• Mechanism Description: The erm genes are a diverse collection of methylases that add one or two methyl groups to the adenine at position 2058 (Escherichia coli numbering) of the 23S rRNA; this modification impairs the binding of macrolides to ribosomes, and thus reduces the inhibitory activity of these agents.

Quinupristin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Mycobacterium fortuitum infection [1]

• Resistant Disease: Mycobacterium fortuitum infection [ICD-11: 1B2Z.2]
• Resistant Drug: Quinupristin
• Molecule Alteration: Missense mutation; Putative initiation codon GTG>CTG
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Mycobacterium peregrinum ATCC14467; 43304
• Experiment for Molecule Alteration: DNA sequencing assay
• Experiment for Drug Resistance: Mueller-Hinton (MH) broth assay
• Mechanism Description: The erm genes are a diverse collection of methylases that add one or two methyl groups to the adenine at position 2058 (Escherichia coli numbering) of the 23S rRNA; this modification impairs the binding of macrolides to ribosomes, and thus reduces the inhibitory activity of these agents.

Spiramycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Mycobacterium fortuitum infection [1]

• Resistant Disease: Mycobacterium fortuitum infection [ICD-11: 1B2Z.2]
• Resistant Drug: Spiramycin
• Molecule Alteration: Missense mutation; Putative initiation codon GTG>CTG
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Mycobacterium peregrinum ATCC14467; 43304
• Experiment for Molecule Alteration: DNA sequencing assay
• Experiment for Drug Resistance: Mueller-Hinton (MH) broth assay
• Mechanism Description: The erm genes are a diverse collection of methylases that add one or two methyl groups to the adenine at position 2058 (Escherichia coli numbering) of the 23S rRNA; this modification impairs the binding of macrolides to ribosomes, and thus reduces the inhibitory activity of these agents.

References

• Ref 1: Molecular basis of intrinsic macrolide resistance in clinical isolates of Mycobacterium fortuitum. J Antimicrob Chemother. 2005 Feb;55(2):170-7. doi: 10.1093/jac/dkh523. Epub 2004 Dec 8.