Molecule Information
General Information of the Molecule (ID: Mol00750)
| Name |
16S rRNA (guanine(1405)-N(7))-methyltransferase (RMTA)
,Pseudomonas aeruginosa
|
||||
|---|---|---|---|---|---|
| Synonyms |
16S rRNA m7G1405 methyltransferase
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
rmtA
|
||||
| Sequence |
MSFDDALASILSSKKYRSLCPDTVRRILDQEWGRHKSPKLAVEATRTRLHGICGAYVTPE
SLKAAAAALSVGDVQKALSLHASTKERLAELDCLYDFIFSGGVPHRVLDIACGLNPLALF IRDITSVWACDIHQGLGDVITPFAHHQGLDFTFALQDVMCTPPTETGDLALVFKLLPLLE REQAGAAMALLQALATPRIAVSFPTRSLGGRGKGMEANYSAWFEGALPDEFEIEDTKTIG IELVYMIKRNK Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
7 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Amikacin | |||
| Molecule Alteration | Expression | Intergeneric lateral gene transfer |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Pseudomonas aeruginosa AR-2 | 287 | ||
| Experiment for Molecule Alteration |
PCR screening assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | The 16S rRNA methylase gene has undergone intergeneric horizontal gene transfer from some aminoglycoside producing microorganisms to Pseudomonas aeruginosa, which is called rmtA. rmtA protect bacterial 16S rRNA from intrinsic aminoglycosides by methylation. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Arbekacin | |||
| Molecule Alteration | Expression | Intergeneric lateral gene transfer |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Pseudomonas aeruginosa AR-2 | 287 | ||
| Experiment for Molecule Alteration |
PCR screening assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | The 16S rRNA methylase gene has undergone intergeneric horizontal gene transfer from some aminoglycoside producing microorganisms to Pseudomonas aeruginosa, which is called rmtA. rmtA protect bacterial 16S rRNA from intrinsic aminoglycosides by methylation. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Gentamicin | |||
| Molecule Alteration | Expression | Intergeneric lateral gene transfer |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Pseudomonas aeruginosa AR-2 | 287 | ||
| Experiment for Molecule Alteration |
PCR screening assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | The 16S rRNA methylase gene has undergone intergeneric horizontal gene transfer from some aminoglycoside producing microorganisms to Pseudomonas aeruginosa, which is called rmtA. rmtA protect bacterial 16S rRNA from intrinsic aminoglycosides by methylation. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Isepamicin | |||
| Molecule Alteration | Expression | Intergeneric lateral gene transfer |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Pseudomonas aeruginosa AR-2 | 287 | ||
| Experiment for Molecule Alteration |
PCR screening assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | The 16S rRNA methylase gene has undergone intergeneric horizontal gene transfer from some aminoglycoside producing microorganisms to Pseudomonas aeruginosa, which is called rmtA. rmtA protect bacterial 16S rRNA from intrinsic aminoglycosides by methylation. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Kanamycin | |||
| Molecule Alteration | Expression | Intergeneric lateral gene transfer |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Pseudomonas aeruginosa AR-2 | 287 | ||
| Experiment for Molecule Alteration |
PCR screening assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | The 16S rRNA methylase gene has undergone intergeneric horizontal gene transfer from some aminoglycoside producing microorganisms to Pseudomonas aeruginosa, which is called rmtA. rmtA protect bacterial 16S rRNA from intrinsic aminoglycosides by methylation. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Sisomicin | |||
| Molecule Alteration | Expression | Intergeneric lateral gene transfer |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Pseudomonas aeruginosa AR-2 | 287 | ||
| Experiment for Molecule Alteration |
PCR screening assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | The 16S rRNA methylase gene has undergone intergeneric horizontal gene transfer from some aminoglycoside producing microorganisms to Pseudomonas aeruginosa, which is called rmtA. rmtA protect bacterial 16S rRNA from intrinsic aminoglycosides by methylation. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Tobramycin | |||
| Molecule Alteration | Expression | Intergeneric lateral gene transfer |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Pseudomonas aeruginosa AR-2 | 287 | ||
| Experiment for Molecule Alteration |
PCR screening assay | |||
| Experiment for Drug Resistance |
Agar dilution method assay | |||
| Mechanism Description | The 16S rRNA methylase gene has undergone intergeneric horizontal gene transfer from some aminoglycoside producing microorganisms to Pseudomonas aeruginosa, which is called rmtA. rmtA protect bacterial 16S rRNA from intrinsic aminoglycosides by methylation. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
