Molecule Information
General Information of the Molecule (ID: Mol00745)
| Name |
Aminoglycoside acetyltransferase (AAC)
,Escherichia coli
|
||||
|---|---|---|---|---|---|
| Synonyms |
aac(3)-Ic; aac(3)Ic; acc(3)Ic; Aminoglycoside acetyltransferase
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
aac(3)-Ic
|
||||
| Sequence |
MISTQTKITRLNSQDVGVMRAMLGMFGEAFEDAENYCRAQPSDSYLQDLLCGSGFIAIAA
LQGQEVIGGLAAYVLPKFEQQRKEIYIYDLGVQGAYRRRGIATALINELQRIAHDIGAYV IFVQADYGDDPAVALYTKLGIREDVMHFDIEPQPAA Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
4 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Amikacin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
| Experiment for Molecule Alteration |
PCR mapping and sequencing assay | |||
| Experiment for Drug Resistance |
Macrodilution broth method assay | |||
| Mechanism Description | Aac(3)-Ic gene could contribute to aminoglycoside resistance with a pattern typical of AAC(3)-I enzymes. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Gentamicin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
| Experiment for Molecule Alteration |
PCR mapping and sequencing assay | |||
| Experiment for Drug Resistance |
Macrodilution broth method assay | |||
| Mechanism Description | Aac(3)-Ic gene could contribute to aminoglycoside resistance with a pattern typical of AAC(3)-I enzymes. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Sisomicin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
| Experiment for Molecule Alteration |
PCR mapping and sequencing assay | |||
| Experiment for Drug Resistance |
Macrodilution broth method assay | |||
| Mechanism Description | Aac(3)-Ic gene could contribute to aminoglycoside resistance with a pattern typical of AAC(3)-I enzymes. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Tobramycin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
| Experiment for Molecule Alteration |
PCR mapping and sequencing assay | |||
| Experiment for Drug Resistance |
Macrodilution broth method assay | |||
| Mechanism Description | Aac(3)-Ic gene could contribute to aminoglycoside resistance with a pattern typical of AAC(3)-I enzymes. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
