Molecule Information
General Information of the Molecule (ID: Mol00745)
Name |
Aminoglycoside acetyltransferase (AAC)
,Escherichia coli
|
||||
---|---|---|---|---|---|
Synonyms |
aac(3)-Ic; aac(3)Ic; acc(3)Ic; Aminoglycoside acetyltransferase
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
aac(3)-Ic
|
||||
Sequence |
MISTQTKITRLNSQDVGVMRAMLGMFGEAFEDAENYCRAQPSDSYLQDLLCGSGFIAIAA
LQGQEVIGGLAAYVLPKFEQQRKEIYIYDLGVQGAYRRRGIATALINELQRIAHDIGAYV IFVQADYGDDPAVALYTKLGIREDVMHFDIEPQPAA Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
4 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Pseudomonas aeruginosa infection | [1] | |||
Resistant Disease | Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Amikacin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
Experiment for Molecule Alteration |
PCR mapping and sequencing assay | |||
Experiment for Drug Resistance |
Macrodilution broth method assay | |||
Mechanism Description | Aac(3)-Ic gene could contribute to aminoglycoside resistance with a pattern typical of AAC(3)-I enzymes. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Pseudomonas aeruginosa infection | [1] | |||
Resistant Disease | Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Gentamicin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
Experiment for Molecule Alteration |
PCR mapping and sequencing assay | |||
Experiment for Drug Resistance |
Macrodilution broth method assay | |||
Mechanism Description | Aac(3)-Ic gene could contribute to aminoglycoside resistance with a pattern typical of AAC(3)-I enzymes. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Pseudomonas aeruginosa infection | [1] | |||
Resistant Disease | Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Sisomicin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
Experiment for Molecule Alteration |
PCR mapping and sequencing assay | |||
Experiment for Drug Resistance |
Macrodilution broth method assay | |||
Mechanism Description | Aac(3)-Ic gene could contribute to aminoglycoside resistance with a pattern typical of AAC(3)-I enzymes. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Pseudomonas aeruginosa infection | [1] | |||
Resistant Disease | Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Tobramycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli DH5alpha | 668369 | ||
Experiment for Molecule Alteration |
PCR mapping and sequencing assay | |||
Experiment for Drug Resistance |
Macrodilution broth method assay | |||
Mechanism Description | Aac(3)-Ic gene could contribute to aminoglycoside resistance with a pattern typical of AAC(3)-I enzymes. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.