Molecule Information

General Information of the Molecule (ID: Mol00743)

• Name: Protein QacZ (QACZ) ,Enterococcus faecium
• Synonyms: qacZ; QacZ
• Molecule Type: Protein
• Gene Name: qacZ
• Sequence:
  MPYLYLLLAIVSEVIGSAFLKSSDGFSKLYPTITTIISYLISFYFLSKTMQHLPLNIAYA
  SWSGLGLVLTTIVSVLIFKEQINLISIISIILIIFGVVLLNTFGSSH
• Uniprot ID: A0A088SHQ9_ENTFC

Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Lactobacillales
Family: Enterococcaceae
Genus: Enterococcus
Species: Enterococcus faecalis

Type(s) of Resistant Mechanism of This Molecule

  IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Benzalkonium chloride

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Enterococcal infection [1]

• Resistant Disease: Enterococcal infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Benzalkonium chloride
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Enterococcus faecalis EF-SAVE1; 1244142
• In Vitro Model: Enterococcus faecalis V583ErmS; 1244142
• Experiment for Molecule Alteration: RT-PCR
• Experiment for Drug Resistance: MIC determination assay
• Mechanism Description: A derivative strain of V583, susceptible to erythromycin (V583ErmS), was complemented with pORI23 carrying the qacZ gene (strain EF-SAVE1). MICs of benzalkonium chloride, chlorhexidine and ethidium bromide were determined for the complemented strain and wild-type. The complemented strain, EF-SAVE1, presented a higher MIC of benzalkonium chloride (8 mg/L) than V583ErmS (4 mg/L); the MICs of chlorhexidine and ethidium bromide were the same for both strains, 4 mg/L and 16 mg/L, respectively. Expression of qacZ was found to be higher in EF-SAVE1 and constitutive, i.e. not inducible by any of the three tested bi.

References

• Ref 1: Involvement, and dissemination, of the enterococcal small multidrug resistance transporter QacZ in resistance to quaternary ammonium compounds. J Antimicrob Chemother. 2011 Feb;66(2):283-6. doi: 10.1093/jac/dkq460. Epub 2010 Dec 8.