Molecule Information
General Information of the Molecule (ID: Mol00743)
| Name |
Protein QacZ (QACZ)
,Enterococcus faecium
|
||||
|---|---|---|---|---|---|
| Synonyms |
qacZ; QacZ
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
qacZ
|
||||
| Sequence |
MPYLYLLLAIVSEVIGSAFLKSSDGFSKLYPTITTIISYLISFYFLSKTMQHLPLNIAYA
SWSGLGLVLTTIVSVLIFKEQINLISIISIILIIFGVVLLNTFGSSH Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Enterococcal infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Enterococcal infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Benzalkonium chloride | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Enterococcus faecalis EF-SAVE1 | 1244142 | ||
| Enterococcus faecalis V583ErmS | 1244142 | |||
| Experiment for Molecule Alteration |
RT-PCR | |||
| Experiment for Drug Resistance |
MIC determination assay | |||
| Mechanism Description | A derivative strain of V583, susceptible to erythromycin (V583ErmS), was complemented with pORI23 carrying the qacZ gene (strain EF-SAVE1). MICs of benzalkonium chloride, chlorhexidine and ethidium bromide were determined for the complemented strain and wild-type. The complemented strain, EF-SAVE1, presented a higher MIC of benzalkonium chloride (8 mg/L) than V583ErmS (4 mg/L); the MICs of chlorhexidine and ethidium bromide were the same for both strains, 4 mg/L and 16 mg/L, respectively. Expression of qacZ was found to be higher in EF-SAVE1 and constitutive, i.e. not inducible by any of the three tested bi. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
