General Information of the Molecule (ID: Mol00743)
Name
Protein QacZ (QACZ) ,Enterococcus faecium
Synonyms
qacZ; QacZ
    Click to Show/Hide
Molecule Type
Protein
Gene Name
qacZ
Sequence
MPYLYLLLAIVSEVIGSAFLKSSDGFSKLYPTITTIISYLISFYFLSKTMQHLPLNIAYA
SWSGLGLVLTTIVSVLIFKEQINLISIISIILIIFGVVLLNTFGSSH
    Click to Show/Hide
Uniprot ID
A0A088SHQ9_ENTFC
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Lactobacillales
Family: Enterococcaceae
Genus: Enterococcus
Species: Enterococcus faecalis
Type(s) of Resistant Mechanism of This Molecule
  IDUE: Irregularity in Drug Uptake and Drug Efflux
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Benzalkonium chloride
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Enterococcal infection [ICD-11: 1A00-1C4Z] [1]
Resistant Disease Enterococcal infection [ICD-11: 1A00-1C4Z]
Resistant Drug Benzalkonium chloride
Molecule Alteration Expression
Up-regulation
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Enterococcus faecalis EF-SAVE1 1244142
Enterococcus faecalis V583ErmS 1244142
Experiment for
Molecule Alteration
RT-PCR
Experiment for
Drug Resistance
MIC determination assay
Mechanism Description A derivative strain of V583, susceptible to erythromycin (V583ErmS), was complemented with pORI23 carrying the qacZ gene (strain EF-SAVE1). MICs of benzalkonium chloride, chlorhexidine and ethidium bromide were determined for the complemented strain and wild-type. The complemented strain, EF-SAVE1, presented a higher MIC of benzalkonium chloride (8 mg/L) than V583ErmS (4 mg/L); the MICs of chlorhexidine and ethidium bromide were the same for both strains, 4 mg/L and 16 mg/L, respectively. Expression of qacZ was found to be higher in EF-SAVE1 and constitutive, i.e. not inducible by any of the three tested bi.
References
Ref 1 Involvement, and dissemination, of the enterococcal small multidrug resistance transporter QacZ in resistance to quaternary ammonium compounds. J Antimicrob Chemother. 2011 Feb;66(2):283-6. doi: 10.1093/jac/dkq460. Epub 2010 Dec 8.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.