Molecule Information
General Information of the Molecule (ID: Mol00739)
Name |
Transcriptional regulatory protein (PHOP)
,Klebsiella pneumoniae
|
||||
---|---|---|---|---|---|
Synonyms |
phoP; PhoP
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
phoP
|
||||
Sequence |
MRVLVVEDNALLRHHLKVQLQELGHQVDAAEDAREADYYLGEHLPDIAIVDLGLPDEDGL
SLIRRWRSHDVSLPVLVLTAREGWQDKVEVLSAGADDYVTKPFHIEEVAARMQALLRRNS GLASQVISLPPFQVDLSRRELSVNDQPIKLTAFEYTIMETLIRNRGKVVSKDSLMLQLYP DAELRESHTIYVLMGRLRKKIQAEYPQDVITTVRGQGYLFELR Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Klebsiella pneumoniae | [1] | |||
Resistant Disease | Klebsiella pneumoniae [ICD-11: CA40.0] | |||
Resistant Drug | Colistin | |||
Molecule Alteration | Missense mutation | p.D191Y |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Klebsiella pneumoniae kp75 | 573 | ||
Klebsiella pneumoniae ATCC 53153 | 573 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | The mutated protein PhoP activates the transcription of the pmrHFIJkLM operon, the product of which leads to synthesis of L-amino-arabinose and ultimately to colistin resistance in k. pneumoniae.These modifications create a more positively charged lipopolysaccharide and thus reduce the affinity of LPS to positively charged polymyxins. | |||
Disease Class: Klebsiella pneumoniae infection | [1] | |||
Resistant Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
Resistant Drug | Colistin | |||
Molecule Alteration | Missense mutation | p.D191Y |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Klebsiella pneumoniae kp75 | 573 | ||
Klebsiella pneumoniae ATCC 53153 | 573 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | The mutated protein PhoP activates the transcription of the pmrHFIJkLM operon, the product of which leads to synthesis of L-amino-arabinose and ultimately to colistin resistance in k. pneumoniae.These modifications create a more positively charged lipopolysaccharide and thus reduce the affinity of LPS to positively charged polymyxins. | |||
Disease Class: Klebsiella pneumoniae infection | [1] | |||
Resistant Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
Resistant Drug | Colistin | |||
Molecule Alteration | Missense mutation | p.D191Y |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Klebsiella pneumoniae kp75 | 573 | ||
Klebsiella pneumoniae ATCC 53153 | 573 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Broth microdilution method assay | |||
Mechanism Description | The mutated protein PhoP activates the transcription of the pmrHFIJkLM operon, the product of which leads to synthesis of L-amino-arabinose and ultimately to colistin resistance in k. pneumoniae.These modifications create a more positively charged lipopolysaccharide and thus reduce the affinity of LPS to positively charged polymyxins. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.