General Information of the Molecule (ID: Mol00739)
Name
Transcriptional regulatory protein (PHOP) ,Klebsiella pneumoniae
Synonyms
phoP; PhoP
    Click to Show/Hide
Molecule Type
Protein
Gene Name
phoP
Sequence
MRVLVVEDNALLRHHLKVQLQELGHQVDAAEDAREADYYLGEHLPDIAIVDLGLPDEDGL
SLIRRWRSHDVSLPVLVLTAREGWQDKVEVLSAGADDYVTKPFHIEEVAARMQALLRRNS
GLASQVISLPPFQVDLSRRELSVNDQPIKLTAFEYTIMETLIRNRGKVVSKDSLMLQLYP
DAELRESHTIYVLMGRLRKKIQAEYPQDVITTVRGQGYLFELR
    Click to Show/Hide
Uniprot ID
A0A139ZN42_KLEPN
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Klebsiella
Species: Klebsiella pneumoniae
Type(s) of Resistant Mechanism of This Molecule
  ADTT: Aberration of the Drug's Therapeutic Target
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Colistin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Klebsiella pneumoniae [ICD-11: CA40.0] [1]
Resistant Disease Klebsiella pneumoniae [ICD-11: CA40.0]
Resistant Drug Colistin
Molecule Alteration Missense mutation
p.D191Y
Experimental Note Identified from the Human Clinical Data
In Vitro Model Klebsiella pneumoniae kp75 573
Klebsiella pneumoniae ATCC 53153 573
Experiment for
Molecule Alteration
Whole genome sequence assay
Experiment for
Drug Resistance
Broth microdilution method assay
Mechanism Description The mutated protein PhoP activates the transcription of the pmrHFIJkLM operon, the product of which leads to synthesis of L-amino-arabinose and ultimately to colistin resistance in k. pneumoniae.These modifications create a more positively charged lipopolysaccharide and thus reduce the affinity of LPS to positively charged polymyxins.
Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] [1]
Resistant Disease Klebsiella pneumoniae infection [ICD-11: CA40.1]
Resistant Drug Colistin
Molecule Alteration Missense mutation
p.D191Y
Experimental Note Identified from the Human Clinical Data
In Vitro Model Klebsiella pneumoniae kp75 573
Klebsiella pneumoniae ATCC 53153 573
Experiment for
Molecule Alteration
Whole genome sequence assay
Experiment for
Drug Resistance
Broth microdilution method assay
Mechanism Description The mutated protein PhoP activates the transcription of the pmrHFIJkLM operon, the product of which leads to synthesis of L-amino-arabinose and ultimately to colistin resistance in k. pneumoniae.These modifications create a more positively charged lipopolysaccharide and thus reduce the affinity of LPS to positively charged polymyxins.
Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] [1]
Resistant Disease Klebsiella pneumoniae infection [ICD-11: CA40.1]
Resistant Drug Colistin
Molecule Alteration Missense mutation
p.D191Y
Experimental Note Identified from the Human Clinical Data
In Vitro Model Klebsiella pneumoniae kp75 573
Klebsiella pneumoniae ATCC 53153 573
Experiment for
Molecule Alteration
Whole genome sequence assay
Experiment for
Drug Resistance
Broth microdilution method assay
Mechanism Description The mutated protein PhoP activates the transcription of the pmrHFIJkLM operon, the product of which leads to synthesis of L-amino-arabinose and ultimately to colistin resistance in k. pneumoniae.These modifications create a more positively charged lipopolysaccharide and thus reduce the affinity of LPS to positively charged polymyxins.
References
Ref 1 Heteroresistance to colistin in Klebsiella pneumoniae associated with alterations in the PhoPQ regulatory system. Antimicrob Agents Chemother. 2015 May;59(5):2780-4. doi: 10.1128/AAC.05055-14. Epub 2015 Mar 2.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.