Molecule Information
General Information of the Molecule (ID: Mol00739)
| Name |
Transcriptional regulatory protein (PHOP)
,Klebsiella pneumoniae
|
||||
|---|---|---|---|---|---|
| Synonyms |
phoP; PhoP
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
phoP
|
||||
| Sequence |
MRVLVVEDNALLRHHLKVQLQELGHQVDAAEDAREADYYLGEHLPDIAIVDLGLPDEDGL
SLIRRWRSHDVSLPVLVLTAREGWQDKVEVLSAGADDYVTKPFHIEEVAARMQALLRRNS GLASQVISLPPFQVDLSRRELSVNDQPIKLTAFEYTIMETLIRNRGKVVSKDSLMLQLYP DAELRESHTIYVLMGRLRKKIQAEYPQDVITTVRGQGYLFELR Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Klebsiella pneumoniae [ICD-11: CA40.0] | [1] | |||
| Resistant Disease | Klebsiella pneumoniae [ICD-11: CA40.0] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Missense mutation | p.D191Y |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Klebsiella pneumoniae kp75 | 573 | ||
| Klebsiella pneumoniae ATCC 53153 | 573 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | The mutated protein PhoP activates the transcription of the pmrHFIJkLM operon, the product of which leads to synthesis of L-amino-arabinose and ultimately to colistin resistance in k. pneumoniae.These modifications create a more positively charged lipopolysaccharide and thus reduce the affinity of LPS to positively charged polymyxins. | |||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Resistant Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Missense mutation | p.D191Y |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Klebsiella pneumoniae kp75 | 573 | ||
| Klebsiella pneumoniae ATCC 53153 | 573 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | The mutated protein PhoP activates the transcription of the pmrHFIJkLM operon, the product of which leads to synthesis of L-amino-arabinose and ultimately to colistin resistance in k. pneumoniae.These modifications create a more positively charged lipopolysaccharide and thus reduce the affinity of LPS to positively charged polymyxins. | |||
| Disease Class: Klebsiella pneumoniae infection [ICD-11: CA40.1] | [1] | |||
| Resistant Disease | Klebsiella pneumoniae infection [ICD-11: CA40.1] | |||
| Resistant Drug | Colistin | |||
| Molecule Alteration | Missense mutation | p.D191Y |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Klebsiella pneumoniae kp75 | 573 | ||
| Klebsiella pneumoniae ATCC 53153 | 573 | |||
| Experiment for Molecule Alteration |
Whole genome sequence assay | |||
| Experiment for Drug Resistance |
Broth microdilution method assay | |||
| Mechanism Description | The mutated protein PhoP activates the transcription of the pmrHFIJkLM operon, the product of which leads to synthesis of L-amino-arabinose and ultimately to colistin resistance in k. pneumoniae.These modifications create a more positively charged lipopolysaccharide and thus reduce the affinity of LPS to positively charged polymyxins. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
