Molecule Information
General Information of the Molecule (ID: Mol00716)
| Name |
Zinc finger and BTB domain-containing protein 7A (ZBTB7A)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
Factor binding IST protein 1; FBI-1; Factor that binds to inducer of short transcripts protein 1; HIV-1 1st-binding protein 1; Leukemia/lymphoma-related factor; POZ and Krueppel erythroid myeloid ontogenic factor; POK erythroid myeloid ontogenic factor; Pokemon; Pokemon 1; TTF-I-interacting peptide 21; TIP21; Zinc finger protein 857A; FBI1; LRF; ZBTB7; ZNF857A
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
ZBTB7A
|
||||
| Gene ID | |||||
| Location |
chr19:4043303-4066899[-]
|
||||
| Sequence |
MAGGVDGPIGIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFK
KLFTSGAVVDQQNVYEIDFVSAEALTALMDFAYTATLTVSTANVGDILSAARLLEIPAVS HVCADLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEFFQSNPMNSLPPAAAAAA ASFPWSAFGASDDDLDATKEAVAAAVAAVAAGDCNGLDFYGPGPPAERPPTGDGDEGDSN PGLWPERDEDAPTGGLFPPPVAPPAATQNGHYGRGGEEEAASLSEAAPEPGDSPGFLSGA AEGEDGDGPDVDGLAASTLLQQMMSSVGRAGAAAGDSDEESRADDKGVMDYYLKYFSGAH DGDVYPAWSQKVEKKIRAKAFQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFT RQDKLKVHMRKHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSDH LHRHLKKDGCNGVPSRRGRKPRVRGGAPDPSPGATATPGAPAQPSSPDARRNGQEKHFKD EDEDEDVASPDGLGRLNVAGAGGGGDSGGGPGAATDGNFTAGLA Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
Transcription factor that represses the transcription of a wide range of genes involved in cell proliferation and differentiation. Directly and specifically binds to the consensus sequence 5'-[GA][CA]GACCCCCCCCC-3' and represses transcription both by regulating the organization of chromatin and through the direct recruitment of transcription factors to gene regulatory regions. Negatively regulates SMAD4 transcriptional activity in the TGF-beta signaling pathway through these two mechanisms. That is, recruits the chromatin regulator HDAC1 to the SMAD4-DNA complex and in parallel prevents the recruitment of the transcriptional activators CREBBP and EP300. Collaborates with transcription factors like RELA to modify the accessibility of gene transcription regulatory regions to secondary transcription factors. Also directly interacts with transcription factors like SP1 to prevent their binding to DNA. Functions as an androgen receptor/AR transcriptional corepressor by recruiting NCOR1 and NCOR2 to the androgen response elements/ARE on target genes. Thereby, negatively regulates androgen receptor signaling and androgen-induced cell proliferation. Involved in the switch between fetal and adult globin expression during erythroid cells maturation. Through its interaction with the NuRD complex regulates chromatin at the fetal globin genes to repress their transcription. Specifically represses the transcription of the tumor suppressor ARF isoform from the CDKN2A gene. Efficiently abrogates E2F1-dependent CDKN2A transactivation. Regulates chondrogenesis through the transcriptional repression of specific genes via a mechanism that also requires histone deacetylation. Regulates cell proliferation through the transcriptional regulation of genes involved in glycolysis. Involved in adipogenesis through the regulation of genes involved in adipocyte differentiation. Plays a key role in the differentiation of lymphoid progenitors into B and T lineages. Promotes differentiation towards the B lineage by inhibiting the T-cell instructive Notch signaling pathway through the specific transcriptional repression of Notch downstream target genes. Also regulates osteoclast differentiation. May also play a role, independently of its transcriptional activity, in double-strand break repair via classical non-homologous end joining/cNHEJ. Recruited to double-strand break sites on damage DNA, interacts with the DNA-dependent protein kinase complex and directly regulates its stability and activity in DNA repair. May also modulate the splicing activity of KHDRBS1 toward BCL2L1 in a mechanism which is histone deacetylase-dependent and thereby negatively regulates the pro-apoptotic effect of KHDRBS1.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
5 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Hepatocellular carcinoma [ICD-11: 2C12.02] | [1] | |||
| Metabolic Type | Glucose metabolism | |||
| Resistant Disease | Hepatocellular carcinoma [ICD-11: 2C12.02] | |||
| Resistant Drug | Cabozantinib | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vivo Model | HCC patients | Homo Sapiens | ||
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
Cell prognosis assay | |||
| Mechanism Description | In the present work, our results, for the first time, revealed that FBI-1 induced the aerobic glycolysis/Warburg effect of HCC cells by enhancing the expression of HIF-1alpha and its target genes. | |||
| Disease Class: Hepatocellular carcinoma [ICD-11: 2C12.02] | [1] | |||
| Metabolic Type | Glucose metabolism | |||
| Resistant Disease | Hepatocellular carcinoma [ICD-11: 2C12.02] | |||
| Resistant Drug | Cabozantinib | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | HepG2 cells | Liver | Homo sapiens (Human) | CVCL_0027 |
| MHCC97-H cells | Liver | Homo sapiens (Human) | CVCL_4972 | |
| MHCC97-L cells | Liver | Homo sapiens (Human) | CVCL_4973 | |
| L-02 hepatic non-tumor cells | Liver | Homo sapiens (Human) | CVCL_6926 | |
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
MTT assay | |||
| Mechanism Description | In the present work, our results, for the first time, revealed that FBI-1 induced the aerobic glycolysis/Warburg effect of HCC cells by enhancing the expression of HIF-1alpha and its target genes. | |||
| Disease Class: Hepatocellular carcinoma [ICD-11: 2C12.02] | [1] | |||
| Metabolic Type | Glucose metabolism | |||
| Resistant Disease | Hepatocellular carcinoma [ICD-11: 2C12.02] | |||
| Resistant Drug | Cabozantinib | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vivo Model | Nude mice, MHCC97-H cells | Mice | ||
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
Tumor volume assay | |||
| Mechanism Description | In the present work, our results, for the first time, revealed that FBI-1 induced the aerobic glycolysis/Warburg effect of HCC cells by enhancing the expression of HIF-1alpha and its target genes. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Osteosarcoma [ICD-11: 2B51.0] | [2] | |||
| Resistant Disease | Osteosarcoma [ICD-11: 2B51.0] | |||
| Resistant Drug | Cisplatin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | ZBTB7A/LINC00473/IL24 signaling pathway | Regulation | N.A. | |
| In Vitro Model | MG63 cells | Bone marrow | Homo sapiens (Human) | CVCL_0426 |
| U2OS cells | Bone | Homo sapiens (Human) | CVCL_0042 | |
| Experiment for Molecule Alteration |
qPCR | |||
| Experiment for Drug Resistance |
CCK8 assay | |||
| Mechanism Description | Elevated ZBTB7A inhibits cisplatin-induced apoptosis by repressing LINC00473 expression. The ZBTB7A-LINC00473-IL24 signaling axis plays an important role in regulating osteosarcoma chemoresistance. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Hepatocellular carcinoma [ICD-11: 2C12.02] | [1] | |||
| Metabolic Type | Glucose metabolism | |||
| Resistant Disease | Hepatocellular carcinoma [ICD-11: 2C12.02] | |||
| Resistant Drug | Lenvatinib | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vivo Model | HCC patients | Homo Sapiens | ||
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
Cell prognosis assay | |||
| Mechanism Description | In the present work, our results, for the first time, revealed that FBI-1 induced the aerobic glycolysis/Warburg effect of HCC cells by enhancing the expression of HIF-1alpha and its target genes. | |||
| Disease Class: Hepatocellular carcinoma [ICD-11: 2C12.02] | [1] | |||
| Metabolic Type | Glucose metabolism | |||
| Resistant Disease | Hepatocellular carcinoma [ICD-11: 2C12.02] | |||
| Resistant Drug | Lenvatinib | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | HepG2 cells | Liver | Homo sapiens (Human) | CVCL_0027 |
| MHCC97-H cells | Liver | Homo sapiens (Human) | CVCL_4972 | |
| MHCC97-L cells | Liver | Homo sapiens (Human) | CVCL_4973 | |
| L-02 hepatic non-tumor cells | Liver | Homo sapiens (Human) | CVCL_6926 | |
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
MTT assay | |||
| Mechanism Description | In the present work, our results, for the first time, revealed that FBI-1 induced the aerobic glycolysis/Warburg effect of HCC cells by enhancing the expression of HIF-1alpha and its target genes. | |||
| Disease Class: Hepatocellular carcinoma [ICD-11: 2C12.02] | [1] | |||
| Metabolic Type | Glucose metabolism | |||
| Resistant Disease | Hepatocellular carcinoma [ICD-11: 2C12.02] | |||
| Resistant Drug | Lenvatinib | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vivo Model | Nude mice, MHCC97-H cells | Mice | ||
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
Tumor volume assay | |||
| Mechanism Description | In the present work, our results, for the first time, revealed that FBI-1 induced the aerobic glycolysis/Warburg effect of HCC cells by enhancing the expression of HIF-1alpha and its target genes. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Hepatocellular carcinoma [ICD-11: 2C12.02] | [1] | |||
| Metabolic Type | Glucose metabolism | |||
| Resistant Disease | Hepatocellular carcinoma [ICD-11: 2C12.02] | |||
| Resistant Drug | Regorafenib | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vivo Model | HCC patients | Homo Sapiens | ||
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
Cell prognosis assay | |||
| Mechanism Description | In the present work, our results, for the first time, revealed that FBI-1 induced the aerobic glycolysis/Warburg effect of HCC cells by enhancing the expression of HIF-1alpha and its target genes. | |||
| Disease Class: Hepatocellular carcinoma [ICD-11: 2C12.02] | [1] | |||
| Metabolic Type | Glucose metabolism | |||
| Resistant Disease | Hepatocellular carcinoma [ICD-11: 2C12.02] | |||
| Resistant Drug | Regorafenib | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | HepG2 cells | Liver | Homo sapiens (Human) | CVCL_0027 |
| MHCC97-H cells | Liver | Homo sapiens (Human) | CVCL_4972 | |
| MHCC97-L cells | Liver | Homo sapiens (Human) | CVCL_4973 | |
| L-02 hepatic non-tumor cells | Liver | Homo sapiens (Human) | CVCL_6926 | |
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
MTT assay | |||
| Mechanism Description | In the present work, our results, for the first time, revealed that FBI-1 induced the aerobic glycolysis/Warburg effect of HCC cells by enhancing the expression of HIF-1alpha and its target genes. | |||
| Disease Class: Hepatocellular carcinoma [ICD-11: 2C12.02] | [1] | |||
| Metabolic Type | Glucose metabolism | |||
| Resistant Disease | Hepatocellular carcinoma [ICD-11: 2C12.02] | |||
| Resistant Drug | Regorafenib | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vivo Model | Nude mice, MHCC97-H cells | Mice | ||
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
Tumor volume assay | |||
| Mechanism Description | In the present work, our results, for the first time, revealed that FBI-1 induced the aerobic glycolysis/Warburg effect of HCC cells by enhancing the expression of HIF-1alpha and its target genes. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Hepatocellular carcinoma [ICD-11: 2C12.02] | [1] | |||
| Metabolic Type | Glucose metabolism | |||
| Resistant Disease | Hepatocellular carcinoma [ICD-11: 2C12.02] | |||
| Resistant Drug | Sorafenib | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vivo Model | HCC patients | Homo Sapiens | ||
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
Cell prognosis assay | |||
| Mechanism Description | In the present work, our results, for the first time, revealed that FBI-1 induced the aerobic glycolysis/Warburg effect of HCC cells by enhancing the expression of HIF-1alpha and its target genes. | |||
| Disease Class: Hepatocellular carcinoma [ICD-11: 2C12.02] | [1] | |||
| Metabolic Type | Glucose metabolism | |||
| Resistant Disease | Hepatocellular carcinoma [ICD-11: 2C12.02] | |||
| Resistant Drug | Sorafenib | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | HepG2 cells | Liver | Homo sapiens (Human) | CVCL_0027 |
| MHCC97-H cells | Liver | Homo sapiens (Human) | CVCL_4972 | |
| MHCC97-L cells | Liver | Homo sapiens (Human) | CVCL_4973 | |
| L-02 hepatic non-tumor cells | Liver | Homo sapiens (Human) | CVCL_6926 | |
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
MTT assay | |||
| Mechanism Description | In the present work, our results, for the first time, revealed that FBI-1 induced the aerobic glycolysis/Warburg effect of HCC cells by enhancing the expression of HIF-1alpha and its target genes. | |||
| Disease Class: Hepatocellular carcinoma [ICD-11: 2C12.02] | [1] | |||
| Metabolic Type | Glucose metabolism | |||
| Resistant Disease | Hepatocellular carcinoma [ICD-11: 2C12.02] | |||
| Resistant Drug | Sorafenib | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vivo Model | Nude mice, MHCC97-H cells | Mice | ||
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
Tumor volume assay | |||
| Mechanism Description | In the present work, our results, for the first time, revealed that FBI-1 induced the aerobic glycolysis/Warburg effect of HCC cells by enhancing the expression of HIF-1alpha and its target genes. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
