General Information of the Molecule (ID: Mol00707)
Name
Protein Wnt-6 (WNT6) ,Homo sapiens
Molecule Type
Protein
Gene Name
WNT6
Gene ID
7475
Location
chr2:218859805-218874233[+]
Sequence
MLPPLPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPE
VVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAV
TQACSMGELLQCGCQAPRGRAPPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGD
EKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKL
PPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRT
GSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKE
LSLCL
    Click to Show/Hide
Function
Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters. Together with CAV1 may promote chemoresistance of gastric cancer cells to DNA-damaging anthracycline drugs through the activation of the canonical Wnt receptor signaling pathway.
    Click to Show/Hide
Uniprot ID
WNT6_HUMAN
Ensembl ID
ENSG00000115596
HGNC ID
HGNC:12785
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Cisplatin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Urinary bladder cancer [ICD-11: 2C94.Z] [1]
Resistant Disease Urinary bladder cancer [ICD-11: 2C94.Z]
Resistant Drug Cisplatin
Molecule Alteration Expression
Up-regulation
Differential expression of the molecule in resistant disease
Classification of Disease Bladder cancer [ICD-11: 2C94]
The Specified Disease Bladder cancer
The Studied Tissue Bladder tissue
The Expression Level of Disease Section Compare with the Healthy Individual Tissue
p-value: 5.77E-01
Fold-change: 1.13E-02
Z-score: 5.83E-01
Experimental Note Identified from the Human Clinical Data
Cell Pathway Regulation Cell viability Activation hsa05200
Wnt signaling pathway Activation hsa04310
In Vitro Model RT4 cells Bladder Homo sapiens (Human) CVCL_0036
T24 cells Bladder Homo sapiens (Human) CVCL_0554
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTT assay
Mechanism Description Cisplatin-based chemotherapy results in up-regulation of UCA1 expression, UCA1 increases cell viability during cisplatin treatment, UCA1 activates Wnt signaling in a Wnt6-dependent manner, UCA1 promotes cisplatin resistance by up-regulating Wnt6 expression.
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Click to Show/Hide the Resistance Disease of This Class
Bladder cancer [ICD-11: 2C94]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Bladder tissue
The Specified Disease Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.77E-01; Fold-change: -1.21E-01; Z-score: -5.99E-01
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Tissue-specific Molecule Abundances in Healthy Individuals
Click to Show/Hide the Molecule Abundances
References
Ref 1 Long non-coding RNA UCA1 increases chemoresistance of bladder cancer cells by regulating Wnt signaling. FEBS J. 2014 Apr;281(7):1750-8. doi: 10.1111/febs.12737. Epub 2014 Feb 20.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.