Molecule Information
General Information of the Molecule (ID: Mol00697)
| Name |
Urokinase-type plasminogen activator (PLAU)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
U-plasminogen activator; uPA
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
PLAU
|
||||
| Gene ID | |||||
| Location |
chr10:73909177-73917496[+]
|
||||
| Sequence |
MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQ
HCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHN YCRNPDNRRRPWCYVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKII GGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLG RSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICL PSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKML CAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR SHTKEENGLAL Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
Specifically cleaves the zymogen plasminogen to form the active enzyme plasmin.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bladder cancer [ICD-11: 2C94.0] | [1] | |||
| Resistant Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Resistant Drug | Paclitaxel | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell proliferation | Inhibition | hsa05200 | |
| DNA damage repair signaling pathway | Inhibition | hsa03410 | ||
| Myc/Max signaling pathway | Inhibition | hsa04218 | ||
| NF-kappaB signaling pathway | Inhibition | hsa04064 | ||
| Notch signaling pathway | Activation | hsa04330 | ||
| Oxidative stress signaling pathway | Activation | hsa00190 | ||
| In Vitro Model | 5637 cells | Bladder | Homo sapiens (Human) | CVCL_0126 |
| T24 cells | Bladder | Homo sapiens (Human) | CVCL_0554 | |
| BIU87 cells | Bladder | Homo sapiens (Human) | CVCL_6881 | |
| H-bc cells | Bladder | Homo sapiens (Human) | CVCL_BT00 | |
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
MTT assay | |||
| Mechanism Description | The DNA methylation-regulated miR-193a-3p dictates the multi-chemoresistance of bladder cancer via repression of SRSF2/PLAU/HIC2 expression. | |||
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Bladder tissue | |
| The Specified Disease | Bladder cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 6.67E-11; Fold-change: 1.26E+00; Z-score: 5.09E+00 | |
|
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
|
||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
