Molecule Information
General Information of the Molecule (ID: Mol00691)
| Name |
Ubiquitin-conjugating enzyme E2 C (UBE2C)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
(E3-independent) E2 ubiquitin-conjugating enzyme C; E2 ubiquitin-conjugating enzyme C; UbcH10; Ubiquitin carrier protein C; Ubiquitin-protein ligase C; UBCH10
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
UBE2C
|
||||
| Gene ID | |||||
| Location |
chr20:45812576-45816957[+]
|
||||
| Sequence |
MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLF
KWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKE KWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Multiple myeloma [ICD-11: 2A83.0] | [1] | |||
| Sensitive Disease | Multiple myeloma [ICD-11: 2A83.0] | |||
| Sensitive Drug | Bortezomib | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Differential expression of the molecule in resistant disease | ||||
| Classification of Disease | Multiple myeloma [ICD-11: 2A83] | |||
| The Specified Disease | Myeloma | |||
| The Studied Tissue | Peripheral blood | |||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.19E-01 Fold-change: -9.76E-02 Z-score: -6.55E-01 |
|||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | miR631/UbcH10/MDR1 signaling pathway | Regulation | N.A. | |
| In Vitro Model | NCI-H929 cells | Bone marrow | Homo sapiens (Human) | CVCL_1600 |
| U266 cells | Bone marrow | Homo sapiens (Human) | CVCL_0566 | |
| RPMI-8226/BTZ cells | Pancreas | Homo sapiens (Human) | CVCL_XK17 | |
| Experiment for Molecule Alteration |
RT-PCR; Western blot analysis | |||
| Experiment for Drug Resistance |
CCK8 assay | |||
| Mechanism Description | Hsa-miR631 resensitizes bortezomib-resistant multiple myeloma cell lines by inhibiting UbcH10. | |||
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specified Disease | Multiple myeloma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.35E-01; Fold-change: 1.54E-01; Z-score: 4.27E-01 | |
|
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Peripheral blood | |
| The Specified Disease | Multiple myeloma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.19E-01; Fold-change: -2.42E-01; Z-score: -9.36E-02 | |
|
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
|
||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
