General Information of the Molecule (ID: Mol00689)
Name
Twist-related protein 1 (TWST1) ,Homo sapiens
Synonyms
Class A basic helix-loop-helix protein 38; bHLHa38; H-twist; BHLHA38; TWIST
    Click to Show/Hide
Molecule Type
Protein
Gene Name
TWIST1
Gene ID
7291
Location
chr7:19020991-19117636[-]
Sequence
MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGV
GGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQR
TQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAH
ERLSYAFSVWRMEGAWSMSASH
    Click to Show/Hide
3D-structure
PDB ID
8OSB
Classification
Transcription
Method
X-ray diffraction
Resolution
2.90  Å
Function
Acts as a transcriptional regulator. Inhibits myogenesis by sequestrating E proteins, inhibiting trans-activation by MEF2, and inhibiting DNA-binding by MYOD1 through physical interaction. This interaction probably involves the basic domains of both proteins. Also represses expression of proinflammatory cytokines such as TNFA and IL1B. Regulates cranial suture patterning and fusion. Activates transcription as a heterodimer with E proteins. Regulates gene expression differentially, depending on dimer composition. Homodimers induce expression of FGFR2 and POSTN while heterodimers repress FGFR2 and POSTN expression and induce THBS1 expression. Heterodimerization is also required for osteoblast differentiation. Represses the activity of the circadian transcriptional activator: NPAS2-ARNTL/BMAL1 heterodimer (By similarity).
    Click to Show/Hide
Uniprot ID
TWST1_HUMAN
Ensembl ID
ENSG00000122691
HGNC ID
HGNC:12428
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Click to Show/Hide the Full List of Drugs
Cisplatin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Tongue squamous cell carcinoma [ICD-11: 2B62.1] [1]
Resistant Disease Tongue squamous cell carcinoma [ICD-11: 2B62.1]
Resistant Drug Cisplatin
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell apoptosis Inhibition hsa04210
Cell proliferation Activation hsa05200
JNk signaling pathway Activation hsa04010
In Vitro Model Tca8113 cells Tongue Homo sapiens (Human) CVCL_6851
SCC4 cells Tongue Homo sapiens (Human) CVCL_1684
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTT assay
Mechanism Description Overexpression of miR-23a in both SCC-4 and Tca8113 cells markedly increased Twist expression, c-Jun N-terminal kinase (JNk) activity and the half maximal inhibitory concentration (IC50) of cisplain, and decreased cisplatin-induced apoptosis, all of which was abolished by knockdown of Twist or selective JNk inhibitor SP600125. On the other hand, knockdown of miR-23a significantly decreased Twist expression, JNk activity and IC50 of cisplain, and increased cisplatin-induced apoptosis, all of which was completely reversed by overexpression of Twist. The present study for the first time demonstrates that miR-23a promotes cisplatin chemoresistance and protects cisplatin-induced apoptosis in TSCC cells through inducing Twist expression by a JNk-dependent mechanism.
Disease Class: Osteosarcoma [ICD-11: 2B51.0] [2]
Resistant Disease Osteosarcoma [ICD-11: 2B51.0]
Resistant Drug Cisplatin
Molecule Alteration Expression
Down-regulation
Experimental Note Identified from the Human Clinical Data
Cell Pathway Regulation Cell apoptosis Inhibition hsa04210
In Vitro Model MG63 cells Bone marrow Homo sapiens (Human) CVCL_0426
SAOS-2 cells Bone marrow Homo sapiens (Human) CVCL_0548
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
TUNEL assay
Mechanism Description miR-33a is up-regulated in chemoresistant OS and that the miR-33a level is negatively correlated with the TWIST protein level in OS. miR-33a promotes OS cell resistance to cisplatin by down-regulating TWIST.
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Tongue squamous cell carcinoma [ICD-11: 2B62.1] [3]
Sensitive Disease Tongue squamous cell carcinoma [ICD-11: 2B62.1]
Sensitive Drug Cisplatin
Molecule Alteration Expression
Down-regulation
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell migration Inhibition hsa04670
miR181a-Twist1 signaling pathway Regulation N.A.
In Vitro Model CAL27 cells Oral Homo sapiens (Human) CVCL_1107
SCC15 cells Tongue Homo sapiens (Human) CVCL_1681
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTT assay
Mechanism Description Cisplatin chemoresistance induced EMT, enhanced metastatic potential and down-regulated miR-181a in TSCC cells, miR-181a directly targeted Twist1 and then reversed chemoresistance and EMT in TSCC cells, miR-181a-Twist1 pathway may play an important role in the development of cisplatin-chemoresistance.
Epirubicin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Breast cancer [ICD-11: 2C60.3] [4]
Resistant Disease Breast cancer [ICD-11: 2C60.3]
Resistant Drug Epirubicin
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell invasion Activation hsa05200
Cell migration Activation hsa04670
In Vitro Model MCF-7 cells Breast Homo sapiens (Human) CVCL_0031
SUM1315 cells Breast Homo sapiens (Human) CVCL_5589
In Vivo Model Nude mouse xenograft model Mus musculus
Experiment for
Molecule Alteration
qRT-PCR; luciferase reporter assay; Western blot analysis
Experiment for
Drug Resistance
CCK8 toxicity assay
Mechanism Description Twist1 is a target protein of miR-129-5p and positively regulates by NONHSAT101069 in BC cells. and it stimulates epirubicin resistance, migration, invasion, and EMT progression of BC cells.
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Click to Show/Hide the Resistance Disease of This Class
Breast cancer [ICD-11: 2C60]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Breast tissue
The Specified Disease Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.29E-36; Fold-change: -1.44E+00; Z-score: -1.10E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 6.55E-06; Fold-change: -1.21E+00; Z-score: -9.13E-01
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Tissue-specific Molecule Abundances in Healthy Individuals
Click to Show/Hide the Molecule Abundances
References
Ref 1 miR-23a promotes cisplatin chemoresistance and protects against cisplatin-induced apoptosis in tongue squamous cell carcinoma cells through Twist. Oncol Rep. 2015 Feb;33(2):942-50. doi: 10.3892/or.2014.3664. Epub 2014 Dec 10.
Ref 2 miR-33a is up-regulated in chemoresistant osteosarcoma and promotes osteosarcoma cell resistance to cisplatin by down-regulating TWIST. J Exp Clin Cancer Res. 2014 Jan 27;33(1):12. doi: 10.1186/1756-9966-33-12.
Ref 3 miR-181a-Twist1 pathway in the chemoresistance of tongue squamous cell carcinoma. Biochem Biophys Res Commun. 2013 Nov 15;441(2):364-70. doi: 10.1016/j.bbrc.2013.10.051. Epub 2013 Oct 19.
Ref 4 Long non-coding RNA NONHSAT101069 promotes epirubicin resistance, migration, and invasion of breast cancer cells through NONHSAT101069/miR-129-5p/Twist1 axis. Oncogene. 2019 Nov;38(47):7216-7233. doi: 10.1038/s41388-019-0904-5. Epub 2019 Aug 23.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.