Molecule Information
General Information of the Molecule (ID: Mol00686)
Name |
Tetraspanin-12 (TSN12)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
Tspan-12; Tetraspan NET-2; Transmembrane 4 superfamily member 12; NET2; TM4SF12; UNQ774/PRO1568
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
TSPAN12
|
||||
Gene ID | |||||
Location |
chr7:120787320-120858402[-]
|
||||
Sequence |
MAREDSVKCLRCLLYALNLLFWLMSISVLAVSAWMRDYLNNVLTLTAETRVEEAVILTYF
PVVHPVMIAVCCFLIIVGMLGYCGTVKRNLLLLAWYFGSLLVIFCVELACGVWTYEQELM VPVQWSDMVTLKARMTNYGLPRYRWLTHAWNFFQREFKCCGVVYFTDWLEMTEMDWPPDS CCVREFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGISIGVTQILAMIL TITLLWALYYDRREPGTDQMMSLKNDNSQHLSCPSVELLKPSLSRIFEHTSMANSFNTHF EMEEL Click to Show/Hide
|
||||
Function |
Regulator of cell surface receptor signal transduction. Plays a central role in retinal vascularization by regulating norrin (NDP) signal transduction. Acts in concert with norrin (NDP) to promote FZD4 multimerization and subsequent activation of FZD4, leading to promote accumulation of beta-catenin (CTNNB1) and stimulate LEF/TCF-mediated transcriptional programs. Suprisingly, it only activate the norrin (NDP)-dependent activation of FZD4, while it does not activate the Wnt-dependent activation of FZD4, suggesting the existence of a Wnt-independent signaling that also promote accumulation the beta-catenin (CTNNB1) (By similarity). Acts as a regulator of membrane proteinases such as ADAM10 and MMP14/MT1-MMP. Activates ADAM10-dependent cleavage activity of amyloid precursor protein (APP). Activates MMP14/MT1-MMP-dependent cleavage activity.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Lung small cell carcinoma | [1] | |||
Sensitive Disease | Lung small cell carcinoma [ICD-11: 2C25.2] | |||
Sensitive Drug | Cisplatin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | NCI-H446 cells | Lung | Homo sapiens (Human) | CVCL_1562 |
NCI-H69 cells | Lung | Homo sapiens (Human) | CVCL_1579 | |
NCI-H69AR cells | Lung | Homo sapiens (Human) | CVCL_3513 | |
In Vivo Model | Nude mouse xenograft model | Mus musculus | ||
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
CCK8 assay; Annexin V/propidium iodide detection assay; Scratch healing test | |||
Mechanism Description | TSPAN12 promotes chemoresistance and proliferation of SCLC under the regulation of miR495, and TSPAN12 is negatively regulated by miR495. |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Lung small cell carcinoma | [1] | |||
Sensitive Disease | Lung small cell carcinoma [ICD-11: 2C25.2] | |||
Sensitive Drug | Etoposide | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | NCI-H446 cells | Lung | Homo sapiens (Human) | CVCL_1562 |
NCI-H69 cells | Lung | Homo sapiens (Human) | CVCL_1579 | |
NCI-H69AR cells | Lung | Homo sapiens (Human) | CVCL_3513 | |
In Vivo Model | Nude mouse xenograft model | Mus musculus | ||
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
CCK8 assay; Annexin V/propidium iodide detection assay; Scratch healing test | |||
Mechanism Description | TSPAN12 promotes chemoresistance and proliferation of SCLC under the regulation of miR495, and TSPAN12 is negatively regulated by miR495. |
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Lung | |
The Specified Disease | Lung cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.99E-31; Fold-change: -8.28E-01; Z-score: -1.29E+00 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 4.15E-13; Fold-change: -6.98E-01; Z-score: -9.97E-01 | |
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
![]() |
||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.