General Information of the Molecule (ID: Mol00668)
Name
Protransforming growth factor alpha (TGFA) ,Homo sapiens
Synonyms
TGF-alpha; EGF-like TGF; ETGF; TGF type 1
    Click to Show/Hide
Molecule Type
Protein
Gene Name
TGFA
Gene ID
7039
Location
chr2:70447284-70554193[-]
Sequence
MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVL
IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
    Click to Show/Hide
3D-structure
PDB ID
1YUF
Classification
Growth factor
Method
Solution nmr
Resolution
No Resolution Dat Å
Function
TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.
    Click to Show/Hide
Uniprot ID
TGFA_HUMAN
Ensembl ID
ENSG00000163235
HGNC ID
HGNC:11765
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Clinical Trial Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Canertinib
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Prostate cancer [ICD-11: 2C82.0] [1]
Sensitive Disease Prostate cancer [ICD-11: 2C82.0]
Sensitive Drug Canertinib
Molecule Alteration Expression
Up-regulation
Differential expression of the molecule in resistant disease
Classification of Disease Prostate cancer [ICD-11: 2C82]
The Specified Disease Prostate cancer
The Studied Tissue Blood
The Expression Level of Disease Section Compare with the Healthy Individual Tissue
p-value: 8.36E-10
Fold-change: 1.90E-01
Z-score: 6.41E+00
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell migration Activation hsa04670
Cell proliferation Activation hsa05200
EGFR/RAS signaling pathway Activation hsa01521
In Vitro Model DU-145 cells Prostate Homo sapiens (Human) CVCL_0105
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
Promega assay
Mechanism Description The induction of bone metastasis and TkI resistance require miR-203 down-regulation, activation of the EGFR pathway via altered expression of EGFR ligands (EREG and TGFA) and anti-apoptotic proteins (API5, BIRC2, and TRIAP1). Importantly, a sufficient reconstitution of invasiveness and resistance to TkIs treatment was observed in cells transfected with anti-miR-203. In prostate cancer patients, miR-203 levels were inversely correlated with the expression of two EGFR ligands, EREG and TGFA, and an EGFR dependent gene signature.
Investigative Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Tyrphostin AG-1478
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Prostate cancer [ICD-11: 2C82.0] [1]
Sensitive Disease Prostate cancer [ICD-11: 2C82.0]
Sensitive Drug Tyrphostin AG-1478
Molecule Alteration Expression
Up-regulation
Differential expression of the molecule in resistant disease
Classification of Disease Prostate cancer [ICD-11: 2C82]
The Specified Disease Prostate cancer
The Studied Tissue Blood
The Expression Level of Disease Section Compare with the Healthy Individual Tissue
p-value: 8.36E-10
Fold-change: 1.90E-01
Z-score: 6.41E+00
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell migration Activation hsa04670
Cell proliferation Activation hsa05200
EGFR/RAS signaling pathway Activation hsa01521
In Vitro Model DU-145 cells Prostate Homo sapiens (Human) CVCL_0105
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
Promega assay
Mechanism Description The induction of bone metastasis and TkI resistance require miR-203 down-regulation, activation of the EGFR pathway via altered expression of EGFR ligands (EREG and TGFA) and anti-apoptotic proteins (API5, BIRC2, and TRIAP1). Importantly, a sufficient reconstitution of invasiveness and resistance to TkIs treatment was observed in cells transfected with anti-miR-203. In prostate cancer patients, miR-203 levels were inversely correlated with the expression of two EGFR ligands, EREG and TGFA, and an EGFR dependent gene signature.
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Cisplatin
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Anaplastic thyroid carcinoma [ICD-11: 2D10.3] [2]
Sensitive Disease Anaplastic thyroid carcinoma [ICD-11: 2D10.3]
Sensitive Drug Cisplatin
Molecule Alteration Expression
Down-regulation
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell apoptosis Activation hsa04210
Cell viability Inhibition hsa05200
In Vitro Model TPC-1 cells Thyroid Homo sapiens (Human) CVCL_6298
ARO cells Thyroid Homo sapiens (Human) CVCL_0144
HTori3 cell Thyroid Homo sapiens (Human) CVCL_4W02
In Vivo Model Nude mouse xenograft model Mus musculus
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTT assay; Flow cytometry assay; TUNEL assay
Mechanism Description miR-144 could inhibit autophagy of ATC cells by down-regulating TGF-alpha, enhancing the cisplatin-sensitivity of ATC cells.
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Click to Show/Hide the Resistance Disease of This Class
Prostate cancer [ICD-11: 2C82]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Prostate
The Specified Disease Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 9.33E-03; Fold-change: -5.43E-01; Z-score: -1.02E+00
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Thyroid cancer [ICD-11: 2D10]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Thyroid
The Specified Disease Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 9.89E-44; Fold-change: 6.76E-01; Z-score: 3.03E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.45E-27; Fold-change: 6.70E-01; Z-score: 3.09E+00
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Tissue-specific Molecule Abundances in Healthy Individuals
Click to Show/Hide the Molecule Abundances
References
Ref 1 Loss of EGFR signaling regulated miR-203 promotes prostate cancer bone metastasis and tyrosine kinase inhibitors resistance. Oncotarget. 2014 Jun 15;5(11):3770-84. doi: 10.18632/oncotarget.1994.
Ref 2 Effects of miR-144 on the sensitivity of human anaplastic thyroid carcinoma cells to cisplatin by autophagy regulation. Cancer Biol Ther. 2018 Jun 3;19(6):484-496. doi: 10.1080/15384047.2018.1433502. Epub 2018 Mar 26.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.