Molecule Information

General Information of the Molecule (ID: Mol00665)

• Name: Translationally-controlled tumor protein (TCTP) ,Homo sapiens
• Synonyms: TCTP; Fortilin; Histamine-releasing factor; HRF; p23
• Molecule Type: Protein
• Gene Name: TPT1
• Gene ID: 7178
• Location: chr13:45333471-45341284[-]
• Sequence:
  MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGE
  GTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAE
  QIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC
• 3D-structure: PDB ID: 5O9M; Classification: Immune system; Method: X-ray diffraction; Resolution: 1.40 Å
• Function: Involved in calcium binding and microtubule stabilization.
• Uniprot ID: TCTP_HUMAN
• Ensembl ID: ENSG00000133112
• HGNC ID: HGNC:12022

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Cisplatin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Lung cancer [ICD-11: 2C25.5] [1]

• Resistant Disease: Lung cancer [ICD-11: 2C25.5]
• Resistant Drug: Cisplatin
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• Cell Pathway Regulation: Cell apoptosis; Activation; hsa04210
• Cell Pathway Regulation: Cell proliferation; Inhibition; hsa05200
• Cell Pathway Regulation: Cell viability; Inhibition; hsa05200
• Cell Pathway Regulation: pim-3 signaling pathway; Inhibition; hsa05206
• In Vitro Model: A549 cells; Lung; Homo sapiens (Human); CVCL_0023
• Experiment for Molecule Alteration: Western blot analysis
• Experiment for Drug Resistance: MTT assay; Flow cytometry assay
• Mechanism Description: Upregulation of miR-1236-3p could reverse DDP resistance in lung cancer cells through targeting TPT1 and inhibition of the Pim-3 signaling pathway.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Lung cancer [ICD-11: 2C25]

Differential expression of molecule in resistant diseases

• The Studied Tissue: Lung
• The Specified Disease: Lung cancer
• The Expression Level of Disease Section Compare with the Healthy Individual Tissue: p-value: 4.61E-41; Fold-change: -1.70E-01; Z-score: -1.21E+00
• The Expression Level of Disease Section Compare with the Adjacent Tissue: p-value: 6.02E-14; Fold-change: -1.03E-01; Z-score: -8.23E-01

References

• Ref 1: microRNA-1236-3p Regulates DDP Resistance in Lung Cancer Cells. Open Med (Wars). 2019 Jan 16;14:41-51. doi: 10.1515/med-2019-0007. eCollection 2018.