Molecule Information
General Information of the Molecule (ID: Mol00617)
| Name |
Protein S100-A11 (S100A11)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
Calgizzarin; Metastatic lymph node gene 70 protein; MLN 70; Protein S100-C; S100 calcium-binding protein A11; MLN70; S100C
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
S100A11
|
||||
| Gene ID | |||||
| Location |
chr1:152032506-152047907[-]
|
||||
| Sequence |
MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVL
DRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
Facilitates the differentiation and the cornification of keratinocytes.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Osteosarcoma [ICD-11: 2B51.0] | [1] | |||
| Sensitive Disease | Osteosarcoma [ICD-11: 2B51.0] | |||
| Sensitive Drug | Cisplatin | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell viability | Inhibition | hsa05200 | |
| In Vitro Model | MG63 cells | Bone marrow | Homo sapiens (Human) | CVCL_0426 |
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
CCK8 assay | |||
| Mechanism Description | miR-22 overexpression sensitizes MG-63 cells to cisplatin treatment and reduces the expression of S100A11. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
