Molecule Information
General Information of the Molecule (ID: Mol00617)
Name |
Protein S100-A11 (S100A11)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
Calgizzarin; Metastatic lymph node gene 70 protein; MLN 70; Protein S100-C; S100 calcium-binding protein A11; MLN70; S100C
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
S100A11
|
||||
Gene ID | |||||
Location |
chr1:152032506-152047907[-]
|
||||
Sequence |
MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVL
DRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT Click to Show/Hide
|
||||
Function |
Facilitates the differentiation and the cornification of keratinocytes.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Osteosarcoma | [1] | |||
Sensitive Disease | Osteosarcoma [ICD-11: 2B51.0] | |||
Sensitive Drug | Cisplatin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Cell viability | Inhibition | hsa05200 | |
In Vitro Model | MG63 cells | Bone marrow | Homo sapiens (Human) | CVCL_0426 |
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
CCK8 assay | |||
Mechanism Description | miR-22 overexpression sensitizes MG-63 cells to cisplatin treatment and reduces the expression of S100A11. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.