Molecule Information
General Information of the Molecule (ID: Mol00607)
Name |
Heterogeneous nuclear ribonucleoprotein A1 (HNRNPA1)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
hnRNP A1; Helix-destabilizing protein; Single-strand RNA-binding protein; hnRNP core protein A1; HNRPA1
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
HNRNPA1
|
||||
Gene ID | |||||
Location |
chr12:54280193-54287088[+]
|
||||
Sequence |
MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFV
TYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHH LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKA LSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGS GDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGG GSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGS SSSSSYGSGRRF Click to Show/Hide
|
||||
Function |
Involved in the packaging of pre-mRNA into hnRNP particles, transport of poly(A) mRNA from the nucleus to the cytoplasm and modulation of splice site selection. Plays a role in the splicing of pyruvate kinase PKM by binding repressively to sequences flanking PKM exon 9, inhibiting exon 9 inclusion and resulting in exon 10 inclusion and production of the PKM M2 isoform. Binds to the IRES and thereby inhibits the translation of the apoptosis protease activating factor APAF1. May bind to specific miRNA hairpins.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Hepatocellular carcinoma | [1] | |||
Resistant Disease | Hepatocellular carcinoma [ICD-11: 2C12.2] | |||
Resistant Drug | Sorafenib | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | PKM2 mediated glycolysis signaling pathway | Activation | hsa05230 | |
In Vitro Model | HCCLM3 cells | Liver | Homo sapiens (Human) | CVCL_6832 |
Hep3B cells | Liver | Homo sapiens (Human) | CVCL_0326 | |
In Vivo Model | SCID mouse xenograft model | Mus musculus | ||
Experiment for Molecule Alteration |
Western blot analysis; RT-qPCR | |||
Experiment for Drug Resistance |
MTT assay | |||
Mechanism Description | miR-374b/hnRNPA1/PkM2 axis functions as an important mechanism in sorafenib resistance, with sorafenib-induced miR-374b downregulation and subsequently elevated glycolysis. |
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Liver | |
The Specified Disease | Liver cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.41E-05; Fold-change: 4.93E-01; Z-score: 5.87E-01 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 3.15E-04; Fold-change: -6.89E-01; Z-score: -6.25E-01 | |
The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 3.43E-01; Fold-change: -5.74E-01; Z-score: -8.33E-01 | |
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Molecule expression in tissue other than the diseased tissue of patients
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
![]() |
||
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.