Molecule Information

General Information of the Molecule (ID: Mol00566)

• Name: Lysophosphatidic acid acyltransferase beta (AGPAT2) ,Homo sapiens
• Synonyms: 1-acylglycerol-3-phosphate O-acyltransferase 2; 1-AGP acyltransferase 2; 1-AGPAT 2; Lysophosphatidic acid acyltransferase beta; LPAAT-beta
• Molecule Type: Protein
• Gene Name: AGPAT2
• Gene ID: 10555
• Location: chr9:136673143-136687457[-]
• Sequence:
  MELWPCLAAALLLLLLLVQLSRAAEFYAKVALYCALCFTVSAVASLVCLLRHGGRTVENM
  SIIGWFVRSFKYFYGLRFEVRDPRRLQEARPCVIVSNHQSILDMMGLMEVLPERCVQIAK
  RELLFLGPVGLIMYLGGVFFINRQRSSTAMTVMADLGERMVRENLKVWIYPEGTRNDNGD
  LLPFKKGAFYLAVQAQVPIVPVVYSSFSSFYNTKKKFFTSGTVTVQVLEAIPTSGLTAAD
  VPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPAQ
• Function: Converts 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone.
• Uniprot ID: PLCB_HUMAN
• Ensembl ID: ENSG00000169692
• HGNC ID: HGNC:325

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Cisplatin

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Osteosarcoma [1]

• Sensitive Disease: Osteosarcoma [ICD-11: 2B51.0]
• Sensitive Drug: Cisplatin
• Molecule Alteration: Expression; Down-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• In Vitro Model: MG63 cells; Bone marrow; Homo sapiens (Human); CVCL_0426
• In Vitro Model: SAOS-2 cells; Bone marrow; Homo sapiens (Human); CVCL_0548
• In Vitro Model: MG63/CDDP cells; Bone; Homo sapiens (Human); CVCL_0426
• In Vitro Model: SAOS-2/CDDP cells; Bone; Homo sapiens (Human); CVCL_0548
• Experiment for Molecule Alteration: Western blot analysis
• Experiment for Drug Resistance: CCK8 assay; Annexin V-FITC apoptosis assay
• Mechanism Description: microRNA-340-5p modulates cisplatin resistance by targeting LPAATbeta in osteosarcoma.

References

• Ref 1: MicroRNA-340-5p modulates cisplatin resistance by targeting LPAATBeta in osteosarcoma. Braz J Med Biol Res. 2017 Apr 20;50(5):e6359. doi: 10.1590/1414-431X20176359.