Molecule Information

General Information of the Molecule (ID: Mol00530)

• Name: Protein naked cuticle homolog 2 (NKD2) ,Homo sapiens
• Synonyms: Naked-2; hNkd2
• Molecule Type: Protein
• Gene Name: NKD2
• Gene ID: 85409
• Location: chr5:1008802-1038943[+]
• Sequence:
  MGKLQSKHAAAARKRRESPEGDSFVASAYASGRKGAEEAERRARDKQELPNGDPKEGPFR
  EDQCPLQVALPAEKAEGREHPGQLLSADDGERAANREGPRGPGGQRLNIDALQCDVSVEE
  DDRQEWTFTLYDFDNCGKVTREDMSSLMHTIYEVVDASVNHSSGSSKTLRVKLTVSPEPS
  SKRKEGPPAGQDREPTRCRMEGELAEEPRVADRRLSAHVRRPSTDPQPCSERGPYCVDEN
  TERRNHYLDLAGIENYTSRFGPGSPPVQAKQEPQGRASHLQARSRSQEPDTHAVHHRRSQ
  VLVEHVVPASEPAARALDTQPRPKGPEKQFLKSPKGSGKPPGVPASSKSGKAFSYYLPAV
  LPPQAPQDGHHLPQPPPPPYGHKRYRQKGREGHSPLKAPHAQPATVEHEVVRDLPPTPAG
  EGYAVPVIQRHEHHHHHEHHHHHHHHHFHPS
• Function: Cell autonomous antagonist of the canonical Wnt signaling pathway. May activate a second Wnt signaling pathway that controls planar cell polarity (By similarity). Required for processing of TGFA and for targeting of TGFA to the basolateral membrane of polarized epithelial cells.
• Uniprot ID: NKD2_HUMAN
• Ensembl ID: ENSG00000145506
• HGNC ID: HGNC:17046

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Cisplatin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Non-small cell lung cancer [1]

• Resistant Disease: Non-small cell lung cancer [ICD-11: 2C25.Y]
• Resistant Drug: Cisplatin
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• Cell Pathway Regulation: Cell apoptosis; Activation; hsa04210
• In Vitro Model: A549 cells; Lung; Homo sapiens (Human); CVCL_0023
• In Vitro Model: A549/CDDP cells; Lung; Homo sapiens (Human); CVCL_0023
• Experiment for Molecule Alteration: Western blotting analysis
• Experiment for Drug Resistance: Flow cytometry assay
• Mechanism Description: Overexpression of beta-catenin not only plays a role in the NSCLC tumorigenesis but also increases chemoresistance. NkD2 inhibits beta-catenin by binding to Dvl protein. knockdown Ak126698 in A549 will decreased expression of NkD2, increased expression of whole beta-catenin and nuclear translocation of beta-catenin.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Lung cancer [ICD-11: 2C25]

Differential expression of molecule in resistant diseases

• The Studied Tissue: Lung
• The Specified Disease: Lung cancer
• The Expression Level of Disease Section Compare with the Healthy Individual Tissue: p-value: 1.07E-57; Fold-change: -9.64E-01; Z-score: -2.03E+00
• The Expression Level of Disease Section Compare with the Adjacent Tissue: p-value: 4.64E-26; Fold-change: -9.81E-01; Z-score: -1.50E+00

References

• Ref 1: The noncoding RNA expression profile and the effect of lncRNA AK126698 on cisplatin resistance in non-small-cell lung cancer cell. PLoS One. 2013 May 31;8(5):e65309. doi: 10.1371/journal.pone.0065309. Print 2013.