Molecule Information
General Information of the Molecule (ID: Mol00520)
| Name |
N-myc proto-oncogene protein (MYCN)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
Class E basic helix-loop-helix protein 37; bHLHe37; BHLHE37; NMYC
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
MYCN
|
||||
| Gene ID | |||||
| Location |
chr2:15940550-15947007[+]
|
||||
| Sequence |
MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPP
LSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGF SAREKLERAVSEKLQHGRGPPTAGSTAQSPGAGAASPAGRGHGGAAGAGRAGAALPAELA HPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPG GRQTSGGDHKALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNTKAVTTFTIT VRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLK SVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKV VILKKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
Positively regulates the transcription of MYCNOS in neuroblastoma cells.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Glioma [ICD-11: 2A00.1] | [1] | |||
| Sensitive Disease | Glioma [ICD-11: 2A00.1] | |||
| Sensitive Drug | Cisplatin | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Differential expression of the molecule in resistant disease | ||||
| Classification of Disease | Brain cancer [ICD-11: 2A00] | |||
| The Specified Disease | Brain cancer | |||
| The Studied Tissue | Nervous tissue | |||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.55E-11 Fold-change: -2.30E-02 Z-score: -6.81E+00 |
|||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
| Cell invasion | Inhibition | hsa05200 | ||
| Cell viability | Inhibition | hsa05200 | ||
| In Vitro Model | U251 cells | Brain | Homo sapiens (Human) | CVCL_0021 |
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
CCK8 assay | |||
| Mechanism Description | miR-501-3p sensitizes glioma cells to cisplatin via reducing protein levels of MYCN. | |||
| Disease Class: Lung cancer [ICD-11: 2C25.5] | [2] | |||
| Sensitive Disease | Lung cancer [ICD-11: 2C25.5] | |||
| Sensitive Drug | Cisplatin | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | H1975 cells | Lung | Homo sapiens (Human) | CVCL_1511 |
| A549 cells | Lung | Homo sapiens (Human) | CVCL_0023 | |
| HEK293T cells | Kidney | Homo sapiens (Human) | CVCL_0063 | |
| H1299 cells | Lung | Homo sapiens (Human) | CVCL_0060 | |
| HCC827 cells | Lung | Homo sapiens (Human) | CVCL_2063 | |
| NCl-H226 cells | Lung | Homo sapiens (Human) | CVCL_1544 | |
| BEAS-2B cells | Bronchus | Homo sapiens (Human) | CVCL_0168 | |
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
MTT assay; Flow cytometry assay | |||
| Mechanism Description | miR34a sensitizes lung cancer cells to cisplatin via p53/miR34a/MYCN axis, miR34a directly targeted to MYCN to sensitize NSCLC cells to cisplatin. | |||
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Nervous tissue | |
| The Specified Disease | Brain cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.55E-11; Fold-change: -1.11E-01; Z-score: -5.77E-01 | |
|
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Brainstem tissue | |
| The Specified Disease | Glioma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 7.69E-01; Fold-change: -1.25E-01; Z-score: -5.75E-01 | |
|
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | White matter | |
| The Specified Disease | Glioma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.19E-03; Fold-change: -7.25E-01; Z-score: -1.59E+00 | |
|
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Brainstem tissue | |
| The Specified Disease | Neuroectodermal tumor | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.94E-02; Fold-change: -2.03E-01; Z-score: -7.41E-01 | |
|
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Lung | |
| The Specified Disease | Lung cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.06E-02; Fold-change: 5.11E-02; Z-score: 2.71E-01 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.09E-02; Fold-change: 4.42E-02; Z-score: 2.24E-01 | |
|
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
|
||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
