Molecule Information
General Information of the Molecule (ID: Mol00512)
| Name |
Microtubule-associated proteins 1A/1B light chain 3 beta 2 (MAP1LC3B2)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
Microtubule-associated proteins 1A/1B light chain 3B-like
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
MAP1LC3B2
|
||||
| Gene ID | |||||
| Location |
chr12:116548105-116576606[+]
|
||||
| Sequence |
MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNM
SELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVCASQETFG MKLSV Click to Show/Hide
|
||||
| Function |
Ubiquitin-like modifier involved in formation of autophagosomal vacuoles (autophagosomes). Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. In response to cellular stress and upon mitochondria fission, binds C-18 ceramides and anchors autophagolysosomes to outer mitochondrial membranes to eliminate damaged mitochondria. While LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Prostate cancer | [1] | |||
| Resistant Disease | Prostate cancer [ICD-11: 2C82.0] | |||
| Resistant Drug | Sulforaphane | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell proliferation | Activation | hsa05200 | |
| In Vitro Model | LNCaP cells | Prostate | Homo sapiens (Human) | CVCL_0395 |
| PC3 cells | Prostate | Homo sapiens (Human) | CVCL_0035 | |
| Experiment for Molecule Alteration |
qPCR | |||
| Experiment for Drug Resistance |
Cell proliferation assay | |||
| Mechanism Description | Knockdown of LINC01116 with siRNA decreased proliferation of prostate cancer cells, and significantly upregulated several genes including GAPDH (regulates glycolysis), MAP1LC3B2 (autophagy) and H2AFY (chromatin structure) and LncRNA LINC01116 is upregulated in a human prostate cancer cell line, is decreased by SFN treatment, and promotes cell proliferation in a human cancer cell line. | |||
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Prostate | |
| The Specified Disease | Prostate cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.69E-01; Fold-change: 1.39E-01; Z-score: 2.57E-01 | |
|
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
