Molecule Information
General Information of the Molecule (ID: Mol00499)
| Name |
Microphthalmia-associated transcription factor (MITF)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
Class E basic helix-loop-helix protein 32; bHLHe32; BHLHE32
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
MITF
|
||||
| Gene ID | |||||
| Location |
chr3:69739456-69968336[+]
|
||||
| Sequence |
MQSESGIVPDFEVGEEFHEEPKTYYELKSQPLKSSSSAEHPGASKPPISSSSMTSRILLR
QQLMREQMQEQERREQQQKLQAAQFMQQRVPVSQTPAINVSVPTTLPSATQVPMEVLKVQ THLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNS PMAMLTLNSNCEKEGFYKFEEQNRAESECPGMNTHSRASCMQMDDVIDDIISLESSYNEE ILGLMDPALQMANTLPVSGNLIDLYGNQGLPPPGLTISNSCPANLPNIKRELTACIFPTE SEARALAKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDY IRKLQREQQRAKELENRQKKLEHANRHLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNR IIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSK LEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHTC Click to Show/Hide
|
||||
| Function |
Transcription factor that regulates the expression of genes with essential roles in cell differentiation, proliferation and survival. Binds to M-boxes (5'-TCATGTG-3') and symmetrical DNA sequences (E-boxes) (5'-CACGTG-3') found in the promoters of target genes, such as BCL2 and tyrosinase (TYR). Plays an important role in melanocyte development by regulating the expression of tyrosinase (TYR) and tyrosinase-related protein 1 (TYRP1). Plays a critical role in the differentiation of various cell types, such as neural crest-derived melanocytes, mast cells, osteoclasts and optic cup-derived retinal pigment epithelium.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Multiple myeloma [ICD-11: 2A83.0] | [1] | |||
| Sensitive Disease | Multiple myeloma [ICD-11: 2A83.0] | |||
| Sensitive Drug | Dexamethasone | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Differential expression of the molecule in resistant disease | ||||
| Classification of Disease | Multiple myeloma [ICD-11: 2A83] | |||
| The Specified Disease | Myeloma | |||
| The Studied Tissue | Bone marrow | |||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.25E-01 Fold-change: -4.23E-02 Z-score: -1.06E+00 |
|||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
| Cell proliferation | Inhibition | hsa05200 | ||
| PI3K/AKT signaling pathway | Regulation | N.A. | ||
| In Vitro Model | U266 cells | Bone marrow | Homo sapiens (Human) | CVCL_0566 |
| RPMI-8226 cells | Peripheral blood | Homo sapiens (Human) | CVCL_0014 | |
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
MTT assay | |||
| Mechanism Description | miR-137 can improve the dexamethasone sensitivity in multiple myeloma cells by reducing the c-MET expression and further decreasing the AkT phosphorylation via targeting MITF. | |||
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specified Disease | Multiple myeloma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.25E-01; Fold-change: -2.04E-01; Z-score: -3.83E-01 | |
|
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Peripheral blood | |
| The Specified Disease | Multiple myeloma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.99E-01; Fold-change: 2.33E-03; Z-score: 1.49E-02 | |
|
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
|
||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
