Molecule Information
General Information of the Molecule (ID: Mol00497)
| Name |
Merlin (NF2)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
Moesin-ezrin-radixin-like protein; Neurofibromin-2; Schwannomerlin; Schwannomin; SCH
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
NF2
|
||||
| Gene ID | |||||
| Location |
chr22:29603556-29698598[+]
|
||||
| Sequence |
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETW
FFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFL QVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMT PEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALG LHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLC IGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRL LQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTE EEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPT YPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLN ELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKLTLQSAKSRVAFFEEL Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
Probable regulator of the Hippo/SWH (Sav/Wts/Hpo) signaling pathway, a signaling pathway that plays a pivotal role in tumor suppression by restricting proliferation and promoting apoptosis. Along with WWC1 can synergistically induce the phosphorylation of LATS1 and LATS2 and can probably function in the regulation of the Hippo/SWH (Sav/Wts/Hpo) signaling pathway. May act as a membrane stabilizing protein. May inhibit PI3 kinase by binding to AGAP2 and impairing its stimulating activity. Suppresses cell proliferation and tumorigenesis by inhibiting the CUL4A-RBX1-DDB1-VprBP/DCAF1 E3 ubiquitin-protein ligase complex.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Lung adenocarcinoma [ICD-11: 2C25.0] | [1] | |||
| Resistant Disease | Lung adenocarcinoma [ICD-11: 2C25.0] | |||
| Resistant Drug | Afatinib | |||
| Molecule Alteration | Missense mutation | p.R198* |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Cell Pathway Regulation | mTOR signaling pathway | Activation | hsa04150 | |
| Experiment for Molecule Alteration |
Deep amplicon-based resequencing assay; Whole exome sequencing assay | |||
| Experiment for Drug Resistance |
Magnetic resonance imaging assay; Computerized tomography assay | |||
| Mechanism Description | Whole exome sequencing (WES) of the A+C-resistant #16 and #24 tumors did not detect mutations in 23 mTOR-pathway related genes, strongly suggesting that non-mutational processes account for sustained activation of this pathway in these tumors. | |||
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Lung | |
| The Specified Disease | Lung cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.23E-10; Fold-change: 7.49E-02; Z-score: 4.12E-01 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 6.75E-04; Fold-change: 7.89E-02; Z-score: 2.89E-01 | |
|
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
|
||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
