Molecule Information
General Information of the Molecule (ID: Mol00468)
| Name |
LIM and SH3 domain protein 1 (LASP1)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
LASP-1; Metastatic lymph node gene 50 protein; MLN 50; MLN50
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
LASP1
|
||||
| Gene ID | |||||
| Location |
chr17:38869859-38921770[+]
|
||||
| Sequence |
MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQ
SFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNI KYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVA QSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWM YGTVERTGDTGMLPANYVEAI Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
Plays an important role in the regulation of dynamic actin-based, cytoskeletal activities. Agonist-dependent changes in LASP1 phosphorylation may also serve to regulate actin-associated ion transport activities, not only in the parietal cell but also in certain other F-actin-rich secretory epithelial cell types (By similarity).
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Endometrial cancer [ICD-11: 2C76.1] | [1] | |||
| Resistant Disease | Endometrial cancer [ICD-11: 2C76.1] | |||
| Resistant Drug | Paclitaxel | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell proliferation | Inhibition | hsa05200 | |
| In Vitro Model | 293T cells | Breast | Homo sapiens (Human) | CVCL_0063 |
| Ishikawa cells | Endometrium | Homo sapiens (Human) | CVCL_2529 | |
| HEC-1A cells | Uterus | Homo sapiens (Human) | CVCL_0293 | |
| In Vivo Model | Nude mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
CCK8 assay; Transwell migration assay; Matrigel invasion assay; Flow cytometry assay; TUNEL assay; Wound healing assay; Colony formation assay | |||
| Mechanism Description | LINC00672 can down-regulate LASP1 expression as a locus-restricted cofactor for p53-mediated gene suppression, thus impacting EC malig.ncies and chemosensitivity to paclitaxel. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
