Molecule Information
General Information of the Molecule (ID: Mol00441)
Name |
Growth protein 5 inhibitor (ING5)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
p28ING5
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
ING5
|
||||
Gene ID | |||||
Location |
chr2:241687085-241729478[+]
|
||||
Sequence |
MATAMYLEHYLDSIENLPCELQRNFQLMRELDQRTEDKKAEIDILAAEYISTVKTLSPDQ
RVERLQKIQNAYSKCKEYSDDKVQLAMQTYEMVDKHIRRLDADLARFEADLKDKMEGSDF ESSGGRGLKKGRGQKEKRGSRGRGRRTSEEDTPKKKKHKGGSEFTDTILSVHPSDVLDMP VDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQEKRKKK Click to Show/Hide
|
||||
Function |
Component of the HBO1 complex, which specifically mediates acetylation of histone H3 at 'Lys-14' (H3K14ac) and, to a lower extent, acetylation of histone H4. Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. Through chromatin acetylation it may regulate DNA replication and may function as a transcriptional coactivator. Inhibits cell growth, induces a delay in S-phase progression and enhances Fas-induced apoptosis in an INCA1-dependent manner.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Head and neck cancer | [1] | |||
Resistant Disease | Head and neck cancer [ICD-11: 2D42.0] | |||
Resistant Drug | Cisplatin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
Cell colony | Activation | hsa05200 | ||
Cell viability | Activation | hsa05200 | ||
In Vitro Model | SCC25 cells | Oral | Homo sapiens (Human) | CVCL_1682 |
CAL-27 cells | Tongue | Homo sapiens (Human) | CVCL_1107 | |
293T cells | Breast | Homo sapiens (Human) | CVCL_0063 | |
SCC4 cells | Tongue | Homo sapiens (Human) | CVCL_1684 | |
SCC9 cells | Tongue | Homo sapiens (Human) | CVCL_1685 | |
In Vivo Model | BALB/c nude mouse xenograft model | Mus musculus | ||
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
MTT assay; Flow cytometry assay | |||
Mechanism Description | Exosomal miR-196a promotes cisplatin resistance in HNC cells through CDkN1B and ING5 downregulation. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Ovarian cancer | [2] | |||
Resistant Disease | Ovarian cancer [ICD-11: 2C73.0] | |||
Resistant Drug | Paclitaxel | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
Cell proliferation | Activation | hsa05200 | ||
In Vitro Model | SkOV3 cells | Ovary | Homo sapiens (Human) | CVCL_0532 |
A2780 cells | Ovary | Homo sapiens (Human) | CVCL_0134 | |
A2780/Taxol cells | Ovary | Homo sapiens (Human) | CVCL_IJ13 | |
In Vivo Model | Nude mouse xenograft model | Mus musculus | ||
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
MTT assay; Colony formation assay; Apoptosis analysis by FITC immunofluorescence | |||
Mechanism Description | miR1307 promotes ovarian cancer cell chemoresistance by targeting the ING5 expression. |
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Ovary | |
The Specified Disease | Ovarian cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.54E-01; Fold-change: -2.18E-01; Z-score: -7.07E-01 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 8.09E-01; Fold-change: 2.35E-02; Z-score: 8.51E-02 | |
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Head and neck tissue | |
The Specified Disease | Head and neck cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.31E-02; Fold-change: -7.95E-02; Z-score: -3.73E-01 | |
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.