Molecule Information

General Information of the Molecule (ID: Mol00437)

• Name: Interleukin-24 (IL24) ,Homo sapiens
• Synonyms: IL-24; Melanoma differentiation-associated gene 7 protein; MDA-7; Suppression of tumorigenicity 16 protein; MDA7; ST16
• Molecule Type: Protein
• Gene Name: IL24
• Gene ID: 11009
• Location: chr1:206897443-206904139[+]
• Sequence:
  MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQ
  VKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTV
  FKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQL
  DVEAALTKALGEVDILLTWMQKFYKL
• 3D-structure: PDB ID: 6DF3; Classification: Cytokine; Method: X-ray diffraction; Resolution: 2.15 Å
• Function: Has antiproliferative properties on melanoma cells and may contribute to terminal cell differentiation.
• Uniprot ID: IL24_HUMAN
• Ensembl ID: ENSG00000162892
• HGNC ID: HGNC:11346

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Cisplatin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Osteosarcoma [ICD-11: 2B51.0] [1]

• Resistant Disease: Osteosarcoma [ICD-11: 2B51.0]
• Resistant Drug: Cisplatin
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• Cell Pathway Regulation: ZBTB7A/LINC00473/IL24 signaling pathway; Regulation; N.A.
• In Vitro Model: MG63 cells; Bone marrow; Homo sapiens (Human); CVCL_0426
• In Vitro Model: U2OS cells; Bone; Homo sapiens (Human); CVCL_0042
• Experiment for Molecule Alteration: RT-PCR; Dual-Luciferase reporter assay
• Experiment for Drug Resistance: CCK8 assay
• Mechanism Description: LINC00473 promoted the activity of IL24 promoter and elevated IL24 expression. LINC00473 interacts with the transcript factor C/EBPbeta, facilitating its binding to the promoter of IL24, leading to decrease chemoresistance. The ZBTB7A-LINC00473-IL24 signaling axis plays an important role in regulating osteosarcoma chemoresistance.

References

• Ref 1: ZBTB7A Enhances Osteosarcoma Chemoresistance by Transcriptionally Repressing lncRNALINC00473-IL24 Activity. Neoplasia. 2017 Nov;19(11):908-918. doi: 10.1016/j.neo.2017.08.008. Epub 2017 Sep 21.