Molecule Information
General Information of the Molecule (ID: Mol00437)
Name |
Interleukin-24 (IL24)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
IL-24; Melanoma differentiation-associated gene 7 protein; MDA-7; Suppression of tumorigenicity 16 protein; MDA7; ST16
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
IL24
|
||||
Gene ID | |||||
Location |
chr1:206897443-206904139[+]
|
||||
Sequence |
MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQ
VKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTV FKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQL DVEAALTKALGEVDILLTWMQKFYKL Click to Show/Hide
|
||||
Function |
Has antiproliferative properties on melanoma cells and may contribute to terminal cell differentiation.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Osteosarcoma | [1] | |||
Resistant Disease | Osteosarcoma [ICD-11: 2B51.0] | |||
Resistant Drug | Cisplatin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | ZBTB7A/LINC00473/IL24 signaling pathway | Regulation | hsa04630 | |
In Vitro Model | MG63 cells | Bone marrow | Homo sapiens (Human) | CVCL_0426 |
U2OS cells | Bone | Homo sapiens (Human) | CVCL_0042 | |
Experiment for Molecule Alteration |
RT-PCR; Dual-Luciferase reporter assay | |||
Experiment for Drug Resistance |
CCK8 assay | |||
Mechanism Description | LINC00473 promoted the activity of IL24 promoter and elevated IL24 expression. LINC00473 interacts with the transcript factor C/EBPbeta, facilitating its binding to the promoter of IL24, leading to decrease chemoresistance. The ZBTB7A-LINC00473-IL24 signaling axis plays an important role in regulating osteosarcoma chemoresistance. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.