Molecule Information

General Information of the Molecule (ID: Mol00435)

• Name: Interleukin-18 (IL18) ,Homo sapiens
• Synonyms: IL-18; Iboctadekin; Interferon gamma-inducing factor; IFN-gamma-inducing factor; Interleukin-1 gamma; IL-1 gamma; IGIF; IL1F4
• Molecule Type: Protein
• Gene Name: IL18
• Gene ID: 3606
• Location: chr11:112143253-112164096[-]
• Sequence:
  MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQ
  GNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFK
  EMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDEL
  GDRSIMFTVQNED
• Function: Proinflammatory cytokine primarily involved in epithelial barrier repair, polarized T-helper 1 (Th1) cell and natural killer (NK) cell immune responses. Upon binding to IL18R1 and IL18RAP, forms a signaling ternary complex which activates NF-kappa-B, triggering synthesis of inflammatory mediators. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells and natural killer (NK) cells. Involved in transduction of inflammation downstream of pyroptosis: its mature form is specifically released in the extracellular milieu by passing through the gasdermin-D (GSDMD) pore.
• Uniprot ID: IL18_HUMAN
• Ensembl ID: ENSG00000150782
• HGNC ID: HGNC:5986

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 2 drug(s) in total

Pemetrexed

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Malignant pleural mesothelioma [1]

• Sensitive Disease: Malignant pleural mesothelioma [ICD-11: 2C26.0]
• Sensitive Drug: Pemetrexed
• Molecule Alteration: Expression; Down-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• Cell Pathway Regulation: Cell invasion; Inhibition; hsa05200
• Cell Pathway Regulation: Cell proliferation; Inhibition; hsa05200
• In Vitro Model: MSTO-211H cells; Lung; Homo sapiens (Human); CVCL_1430
• In Vitro Model: ACC-MESO1 cells; Lung; Homo sapiens (Human); CVCL_5113
• In Vitro Model: ACC-MESO4 cells; Lung; Homo sapiens (Human); CVCL_5114
• In Vitro Model: NCI-H2052 cells; Lung; Homo sapiens (Human); CVCL_1518
• In Vitro Model: NCI-H2452 cells; Lung; Homo sapiens (Human); CVCL_1553
• In Vitro Model: NCI-H28 cells; Lung; Homo sapiens (Human); CVCL_1555
• Experiment for Molecule Alteration: qRT-PCR
• Experiment for Drug Resistance: MTS assay
• Mechanism Description: miR-379 and miR-411 play a key role in the carcinogenesis of MPM cells by targeting IL-18 and contributing to the sensitivity of MPM cells to SAHA and PEM.

Vorinostat

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Malignant pleural mesothelioma [1]

• Sensitive Disease: Malignant pleural mesothelioma [ICD-11: 2C26.0]
• Sensitive Drug: Vorinostat
• Molecule Alteration: Expression; Down-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• Cell Pathway Regulation: Cell invasion; Inhibition; hsa05200
• Cell Pathway Regulation: Cell proliferation; Inhibition; hsa05200
• In Vitro Model: MSTO-211H cells; Lung; Homo sapiens (Human); CVCL_1430
• In Vitro Model: ACC-MESO1 cells; Lung; Homo sapiens (Human); CVCL_5113
• In Vitro Model: ACC-MESO4 cells; Lung; Homo sapiens (Human); CVCL_5114
• In Vitro Model: NCI-H2052 cells; Lung; Homo sapiens (Human); CVCL_1518
• In Vitro Model: NCI-H2452 cells; Lung; Homo sapiens (Human); CVCL_1553
• In Vitro Model: NCI-H28 cells; Lung; Homo sapiens (Human); CVCL_1555
• Experiment for Molecule Alteration: qRT-PCR
• Experiment for Drug Resistance: MTS assay
• Mechanism Description: miR-379 and miR-411 play a key role in the carcinogenesis of MPM cells by targeting IL-18 and contributing to the sensitivity of MPM cells to SAHA and PEM.

References

• Ref 1: MiR-379/411 cluster regulates IL-18 and contributes to drug resistance in malignant pleural mesothelioma. Oncol Rep. 2014 Dec;32(6):2365-72. doi: 10.3892/or.2014.3481. Epub 2014 Sep 16.