Molecule Information
General Information of the Molecule (ID: Mol00435)
Name |
Interleukin-18 (IL18)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
IL-18; Iboctadekin; Interferon gamma-inducing factor; IFN-gamma-inducing factor; Interleukin-1 gamma; IL-1 gamma; IGIF; IL1F4
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
IL18
|
||||
Gene ID | |||||
Location |
chr11:112143253-112164096[-]
|
||||
Sequence |
MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQ
GNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFK EMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDEL GDRSIMFTVQNED Click to Show/Hide
|
||||
Function |
Proinflammatory cytokine primarily involved in epithelial barrier repair, polarized T-helper 1 (Th1) cell and natural killer (NK) cell immune responses. Upon binding to IL18R1 and IL18RAP, forms a signaling ternary complex which activates NF-kappa-B, triggering synthesis of inflammatory mediators. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells and natural killer (NK) cells. Involved in transduction of inflammation downstream of pyroptosis: its mature form is specifically released in the extracellular milieu by passing through the gasdermin-D (GSDMD) pore.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Malignant pleural mesothelioma | [1] | |||
Sensitive Disease | Malignant pleural mesothelioma [ICD-11: 2C26.0] | |||
Sensitive Drug | Pemetrexed | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Cell invasion | Inhibition | hsa05200 | |
Cell proliferation | Inhibition | hsa05200 | ||
In Vitro Model | MSTO-211H cells | Lung | Homo sapiens (Human) | CVCL_1430 |
ACC-MESO1 cells | Lung | Homo sapiens (Human) | CVCL_5113 | |
ACC-MESO4 cells | Lung | Homo sapiens (Human) | CVCL_5114 | |
NCI-H2052 cells | Lung | Homo sapiens (Human) | CVCL_1518 | |
NCI-H2452 cells | Lung | Homo sapiens (Human) | CVCL_1553 | |
NCI-H28 cells | Lung | Homo sapiens (Human) | CVCL_1555 | |
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
MTS assay | |||
Mechanism Description | miR-379 and miR-411 play a key role in the carcinogenesis of MPM cells by targeting IL-18 and contributing to the sensitivity of MPM cells to SAHA and PEM. |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Malignant pleural mesothelioma | [1] | |||
Sensitive Disease | Malignant pleural mesothelioma [ICD-11: 2C26.0] | |||
Sensitive Drug | Vorinostat | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Cell invasion | Inhibition | hsa05200 | |
Cell proliferation | Inhibition | hsa05200 | ||
In Vitro Model | MSTO-211H cells | Lung | Homo sapiens (Human) | CVCL_1430 |
ACC-MESO1 cells | Lung | Homo sapiens (Human) | CVCL_5113 | |
ACC-MESO4 cells | Lung | Homo sapiens (Human) | CVCL_5114 | |
NCI-H2052 cells | Lung | Homo sapiens (Human) | CVCL_1518 | |
NCI-H2452 cells | Lung | Homo sapiens (Human) | CVCL_1553 | |
NCI-H28 cells | Lung | Homo sapiens (Human) | CVCL_1555 | |
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
MTS assay | |||
Mechanism Description | miR-379 and miR-411 play a key role in the carcinogenesis of MPM cells by targeting IL-18 and contributing to the sensitivity of MPM cells to SAHA and PEM. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.