Molecule Information
General Information of the Molecule (ID: Mol00435)
| Name |
Interleukin-18 (IL18)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
IL-18; Iboctadekin; Interferon gamma-inducing factor; IFN-gamma-inducing factor; Interleukin-1 gamma; IL-1 gamma; IGIF; IL1F4
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
IL18
|
||||
| Gene ID | |||||
| Location |
chr11:112143253-112164096[-]
|
||||
| Sequence |
MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQ
GNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFK EMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDEL GDRSIMFTVQNED Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
Proinflammatory cytokine primarily involved in epithelial barrier repair, polarized T-helper 1 (Th1) cell and natural killer (NK) cell immune responses. Upon binding to IL18R1 and IL18RAP, forms a signaling ternary complex which activates NF-kappa-B, triggering synthesis of inflammatory mediators. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells and natural killer (NK) cells. Involved in transduction of inflammation downstream of pyroptosis: its mature form is specifically released in the extracellular milieu by passing through the gasdermin-D (GSDMD) pore.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Malignant pleural mesothelioma [ICD-11: 2C26.0] | [1] | |||
| Sensitive Disease | Malignant pleural mesothelioma [ICD-11: 2C26.0] | |||
| Sensitive Drug | Pemetrexed | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell invasion | Inhibition | hsa05200 | |
| Cell proliferation | Inhibition | hsa05200 | ||
| In Vitro Model | MSTO-211H cells | Lung | Homo sapiens (Human) | CVCL_1430 |
| ACC-MESO1 cells | Lung | Homo sapiens (Human) | CVCL_5113 | |
| ACC-MESO4 cells | Lung | Homo sapiens (Human) | CVCL_5114 | |
| NCI-H2052 cells | Lung | Homo sapiens (Human) | CVCL_1518 | |
| NCI-H2452 cells | Lung | Homo sapiens (Human) | CVCL_1553 | |
| NCI-H28 cells | Lung | Homo sapiens (Human) | CVCL_1555 | |
| Experiment for Molecule Alteration |
qRT-PCR | |||
| Experiment for Drug Resistance |
MTS assay | |||
| Mechanism Description | miR-379 and miR-411 play a key role in the carcinogenesis of MPM cells by targeting IL-18 and contributing to the sensitivity of MPM cells to SAHA and PEM. | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Malignant pleural mesothelioma [ICD-11: 2C26.0] | [1] | |||
| Sensitive Disease | Malignant pleural mesothelioma [ICD-11: 2C26.0] | |||
| Sensitive Drug | Vorinostat | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell invasion | Inhibition | hsa05200 | |
| Cell proliferation | Inhibition | hsa05200 | ||
| In Vitro Model | MSTO-211H cells | Lung | Homo sapiens (Human) | CVCL_1430 |
| ACC-MESO1 cells | Lung | Homo sapiens (Human) | CVCL_5113 | |
| ACC-MESO4 cells | Lung | Homo sapiens (Human) | CVCL_5114 | |
| NCI-H2052 cells | Lung | Homo sapiens (Human) | CVCL_1518 | |
| NCI-H2452 cells | Lung | Homo sapiens (Human) | CVCL_1553 | |
| NCI-H28 cells | Lung | Homo sapiens (Human) | CVCL_1555 | |
| Experiment for Molecule Alteration |
qRT-PCR | |||
| Experiment for Drug Resistance |
MTS assay | |||
| Mechanism Description | miR-379 and miR-411 play a key role in the carcinogenesis of MPM cells by targeting IL-18 and contributing to the sensitivity of MPM cells to SAHA and PEM. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
