Molecule Information

General Information of the Molecule (ID: Mol00420)

• Name: Homeobox protein Hox-D8 (HOXD8) ,Homo sapiens
• Synonyms: Homeobox protein Hox-4E; Homeobox protein Hox-5.4; HOX4E
• Molecule Type: Protein
• Gene Name: HOXD8
• Gene ID: 3234
• Location: chr2:176129694-176132695[+]
• Sequence:
  MSSYFVNPLYSKYKAAAAAAAAAGEAINPTYYDCHFAPEVGGRHAAAAAALQLYGNSAAG
  FPHAPPQAHAHPHPSPPPSGTGCGGREGRGQEYFHPGGGSPAAAYQAAPPPPPHPPPPPP
  PPPCGGIACHGEPAKFYGYDNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSS
  SPSQMFPWMRPQAAPGRRRGRQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHALALTERQ
  VKIWFQNRRMKWKKENNKDKFPVSRQEVKDGETKKEAQELEEDRAEGLTN
• Function: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
• Uniprot ID: HXD8_HUMAN
• Ensembl ID: ENSG00000175879
• HGNC ID: HGNC:5139

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Investigative Drug(s) 1 drug(s) in total

Braf inhibitor

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Melanoma [1]

• Resistant Disease: Melanoma [ICD-11: 2C30.0]
• Resistant Drug: Braf inhibitor
• Molecule Alteration: Mutation; .
• Experimental Note: Identified from the Human Clinical Data
• Cell Pathway Regulation: AKT signaling pathway; Activation; hsa04151
• Experiment for Molecule Alteration: Next-generation sequencing assay
• Mechanism Description: Earlier, it was demonstrated that RAC1codon29 mutant melanomas are resistant to this therapy. Later, it was found that a rare genetic alteration, the mutation of HOXD8, can also be the cause of primary resistance to BRAF inhibitors.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Melanoma [ICD-11: 2C30]

Differential expression of molecule in resistant diseases

• The Studied Tissue: Skin
• The Specified Disease: Melanoma
• The Expression Level of Disease Section Compare with the Healthy Individual Tissue: p-value: 3.82E-01; Fold-change: 1.77E-01; Z-score: 2.13E-01

References

• Ref 1: Genetic progression of malignant melanoma. Cancer Metastasis Rev. 2016 Mar;35(1):93-107. doi: 10.1007/s10555-016-9613-5.