Molecule Information
General Information of the Molecule (ID: Mol00420)
Name |
Homeobox protein Hox-D8 (HOXD8)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
Homeobox protein Hox-4E; Homeobox protein Hox-5.4; HOX4E
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
HOXD8
|
||||
Gene ID | |||||
Location |
chr2:176129694-176132695[+]
|
||||
Sequence |
MSSYFVNPLYSKYKAAAAAAAAAGEAINPTYYDCHFAPEVGGRHAAAAAALQLYGNSAAG
FPHAPPQAHAHPHPSPPPSGTGCGGREGRGQEYFHPGGGSPAAAYQAAPPPPPHPPPPPP PPPCGGIACHGEPAKFYGYDNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSS SPSQMFPWMRPQAAPGRRRGRQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHALALTERQ VKIWFQNRRMKWKKENNKDKFPVSRQEVKDGETKKEAQELEEDRAEGLTN Click to Show/Hide
|
||||
Function |
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Investigative Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Melanoma | [1] | |||
Resistant Disease | Melanoma [ICD-11: 2C30.0] | |||
Resistant Drug | Braf inhibitor | |||
Molecule Alteration | Mutation | . |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | AKT signaling pathway | Activation | hsa04151 | |
Experiment for Molecule Alteration |
Next-generation sequencing assay | |||
Mechanism Description | Earlier, it was demonstrated that RAC1codon29 mutant melanomas are resistant to this therapy. Later, it was found that a rare genetic alteration, the mutation of HOXD8, can also be the cause of primary resistance to BRAF inhibitors. |
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Skin | |
The Specified Disease | Melanoma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.82E-01; Fold-change: 1.77E-01; Z-score: 2.13E-01 | |
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.