Molecule Information
General Information of the Molecule (ID: Mol00417)
| Name |
Homeobox protein Hox-A3 (HOXA3)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
Homeobox protein Hox-1E; HOX1E
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
HOXA3
|
||||
| Gene ID | |||||
| Location |
chr7:27106184-27152583[-]
|
||||
| Sequence |
MQKATYYDSSAIYGGYPYQAANGFAYNANQQPYPASAALGADGEYHRPACSLQSPSSAGG
HPKAHELSEACLRTLSAPPSQPPSLGEPPLHPPPPQAAPPAPQPPQPAPQPPAPTPAAPP PPSSASPPQNASNNPTPANAAKSPLLNSPTVAKQIFPWMKESRQNTKQKTSSSSSGESCA GDKSPPGQASSKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQ NRRMKYKKDQKGKGMLTSSGGQSPSRSPVPPGAGGYLNSMHSLVNSVPYEPQSPPPFSKP PQGTYGLPPASYPASLPSCAPPPPPQKRYTAAGAGAGGTPDYDPHAHGLQGNGSYGTPHI QGSPVFVGGSYVEPMSNSGPALFGLTHLPHAASGAMDYGGAGPLGSGHHHGPGPGEPHPT YTDLTGHHPSQGRIQEAPKLTHL Click to Show/Hide
|
||||
| Function |
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Acute lymphocytic leukemia [ICD-11: 2B33.0] | [1] | |||
| Resistant Disease | Acute lymphocytic leukemia [ICD-11: 2B33.0] | |||
| Resistant Drug | Dexamethasone | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
| Cell proliferation | Activation | hsa05200 | ||
| EGFR/RAS/RAF/MEK/ERK signaling pathway | Activation | hsa01521 | ||
| In Vitro Model | Jurkat cells | Pleural effusion | Homo sapiens (Human) | CVCL_0065 |
| CCRF-CEM cells | Pleural effusion | Homo sapiens (Human) | CVCL_0207 | |
| Experiment for Molecule Alteration |
Western blot analysis; RT-qPCR | |||
| Experiment for Drug Resistance |
CCK8 assay; Flow cytometry assay | |||
| Mechanism Description | TCF7L2 activated HOXA-AS2 decreased the glucocorticoid sensitivity in acute lymphoblastic leukemia through regulating HOXA3/EGFR/Ras/Raf/MEk/ERk pathway. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Acute lymphocytic leukemia [ICD-11: 2B33.0] | [1] | |||
| Resistant Disease | Acute lymphocytic leukemia [ICD-11: 2B33.0] | |||
| Resistant Drug | Prednisone | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
| Cell proliferation | Activation | hsa05200 | ||
| EGFR/RAS/RAF/MEK/ERK signaling pathway | Activation | hsa01521 | ||
| In Vitro Model | Jurkat cells | Pleural effusion | Homo sapiens (Human) | CVCL_0065 |
| CCRF-CEM cells | Pleural effusion | Homo sapiens (Human) | CVCL_0207 | |
| Experiment for Molecule Alteration |
Western blot analysis; RT-qPCR | |||
| Experiment for Drug Resistance |
CCK8 assay; Flow cytometry assay | |||
| Mechanism Description | TCF7L2 activated HOXA-AS2 decreased the glucocorticoid sensitivity in acute lymphoblastic leukemia through regulating HOXA3/EGFR/Ras/Raf/MEk/ERk pathway. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
