Molecule Information
General Information of the Molecule (ID: Mol00403)
Name |
Proheparin-binding EGF-like growth factor (HBEGF)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
HB-EGF; HBEGF; Diphtheria toxin receptor; DT-R; DTR; DTS; HEGFL
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
HBEGF
|
||||
Gene ID | |||||
Location |
chr5:140332843-140346603[-]
|
||||
Sequence |
MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRK
VRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGE CKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVG LLMFRYHRRGGYDVENEEKVKLGMTNSH Click to Show/Hide
|
||||
Function |
Growth factor that mediates its effects via EGFR, ERBB2 and ERBB4. Required for normal cardiac valve formation and normal heart function. Promotes smooth muscle cell proliferation. May be involved in macrophage-mediated cellular proliferation. It is mitogenic for fibroblasts, but not endothelial cells. It is able to bind EGF receptor/EGFR with higher affinity than EGF itself and is a far more potent mitogen for smooth muscle cells than EGF. Also acts as a diphtheria toxin receptor.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Head and neck squamous cell carcinoma | [1] | |||
Resistant Disease | Head and neck squamous cell carcinoma [ICD-11: 2D42.1] | |||
Resistant Drug | Cetuximab | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Cell proliferation | Activation | hsa05200 | |
In Vitro Model | SCC1 cells | Tongue | Homo sapiens (Human) | CVCL_A5SA |
1Cc8 cells | Epithelium | Homo sapiens (Human) | CVCL_L893 | |
In Vivo Model | Nude mouse xenograft model | Mus musculus | ||
Experiment for Molecule Alteration |
Immunoblotting analysis | |||
Experiment for Drug Resistance |
MTS assay | |||
Mechanism Description | HB-EGF can induce EMT, enhance metastasis, and modulate chemotherapy resistance. Increased expression of HB-EGF due to down-regulation of miR-212 is a possible mechanism of cetuximab resistance. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.