Molecule Information
General Information of the Molecule (ID: Mol00374)
Name |
Mitochondrial fission 1 protein (FIS1)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
FIS1 homolog; hFis1; Tetratricopeptide repeat protein 11; TPR repeat protein 11; TTC11; CGI-135
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
FIS1
|
||||
Gene ID | |||||
Location |
chr7:101239458-101252316[-]
|
||||
Sequence |
MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEE
LLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKK DGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS Click to Show/Hide
|
||||
Function |
Involved in the fragmentation of the mitochondrial network and its perinuclear clustering. Plays a minor role in the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface and mitochondrial fission. Can induce cytochrome c release from the mitochondrion to the cytosol, ultimately leading to apoptosis. Also mediates peroxisomal fission.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Tongue squamous cell carcinoma | [1] | |||
Resistant Disease | Tongue squamous cell carcinoma [ICD-11: 2B62.1] | |||
Resistant Drug | Cisplatin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
Mitochondrial apoptotic signaling pathway | Regulation | hsa04210 | ||
In Vitro Model | CAL27 cells | Oral | Homo sapiens (Human) | CVCL_1107 |
SCC9 cells | Tongue | Homo sapiens (Human) | CVCL_1685 | |
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
TUNEL assay; Flow cytometry assay | |||
Mechanism Description | FIS1 is able to regulate mitochondrial fission and cisplatin sensitivity. miR-483-5p is responsible for the downregulation of FIS1 and can suppress mitochondrial fission and apoptosis by targeting FIS1. Mitochondrial fission affects cisplatin sensitivity via the miR-483-5p-FIS1 axis in cancer cells. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.