Molecule Information

General Information of the Molecule (ID: Mol00374)

• Name: Mitochondrial fission 1 protein (FIS1) ,Homo sapiens
• Synonyms: FIS1 homolog; hFis1; Tetratricopeptide repeat protein 11; TPR repeat protein 11; TTC11; CGI-135
• Molecule Type: Protein
• Gene Name: FIS1
• Gene ID: 51024
• Location: chr7:101239458-101252316[-]
• Sequence:
  MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEE
  LLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKK
  DGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS
• 3D-structure: PDB ID: 1PC2; Classification: Unknown function; Method: Solution nmr; Resolution: No Resolution Dat Å
• Function: Involved in the fragmentation of the mitochondrial network and its perinuclear clustering. Plays a minor role in the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface and mitochondrial fission. Can induce cytochrome c release from the mitochondrion to the cytosol, ultimately leading to apoptosis. Also mediates peroxisomal fission.
• Uniprot ID: FIS1_HUMAN
• Ensembl ID: ENSG00000214253
• HGNC ID: HGNC:21689

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Cisplatin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Tongue squamous cell carcinoma [ICD-11: 2B62.1] [1]

• Resistant Disease: Tongue squamous cell carcinoma [ICD-11: 2B62.1]
• Resistant Drug: Cisplatin
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• Cell Pathway Regulation: Cell apoptosis; Inhibition; hsa04210
• Cell Pathway Regulation: Mitochondrial apoptotic signaling pathway; Regulation; N.A.
• In Vitro Model: CAL27 cells; Oral; Homo sapiens (Human); CVCL_1107
• In Vitro Model: SCC9 cells; Tongue; Homo sapiens (Human); CVCL_1685
• Experiment for Molecule Alteration: Western blot analysis
• Experiment for Drug Resistance: TUNEL assay; Flow cytometry assay
• Mechanism Description: FIS1 is able to regulate mitochondrial fission and cisplatin sensitivity. miR-483-5p is responsible for the downregulation of FIS1 and can suppress mitochondrial fission and apoptosis by targeting FIS1. Mitochondrial fission affects cisplatin sensitivity via the miR-483-5p-FIS1 axis in cancer cells.

References

• Ref 1: miR-483-5p determines mitochondrial fission and cisplatin sensitivity in tongue squamous cell carcinoma by targeting FIS1. Cancer Lett. 2015 Jul 1;362(2):183-91. doi: 10.1016/j.canlet.2015.03.045. Epub 2015 Apr 2.