Molecule Information
General Information of the Molecule (ID: Mol00359)
| Name |
Carboxylesterase 4A (CES4A)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
CES8; UNQ440/PRO873
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
CES4A
|
||||
| Gene ID | |||||
| Location |
chr16:66988589-67009758[+]
|
||||
| Sequence |
MRWILCWSLTLCLMAQTALGALHTKRPQVVTKYGTLQGKQMHVGKTPIQVFLGVPFSRPP
LGILRFAPPEPPEPWKGIRDATTYPPGCLQESWGQLASMYVSTRERYKWLRFSEDCLYLN VYAPARAPGDPQLPVMVWFPGGAFIVGAASSYEGSDLAAREKVVLVFLQHRLGIFGFLST DDSHARGNWGLLDQMAALRWVQENIAAFGGDPGNVTLFGQSAGAMSISGLMMSPLASGLF HRAISQSGTALFRLFITSNPLKVAKKVAHLAGCNHNSTQILVNCLRALSGTKVMRVSNKM RFLQLNFQRDPEEIIWSMSPVVDGVVIPDDPLVLLTQGKVSSVPYLLGVNNLEFNWLLPY IMKFPLNRQAMRKETITKMLWSTRTLLNITKEQVPLVVEEYLDNVNEHDWKMLRNRMMDI VQDATFVYATLQTAHYHRDAGLPVYLYEFEHHARGIIVKPRTDGADHGDEMYFLFGGPFA TGLSMGKEKALSLQMMKYWANFARTGNPNDGNLPCWPRYNKDEKYLQLDFTTRVGMKLKE KKMAFWMSLYQSQRPEKQRQF Click to Show/Hide
|
||||
| Function |
Probable carboxylesterase.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Ovarian cancer [ICD-11: 2C73.0] | [1] | |||
| Resistant Disease | Ovarian cancer [ICD-11: 2C73.0] | |||
| Resistant Drug | Carboplatin | |||
| Molecule Alteration | Missense mutation | p.P55S |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Cell Pathway Regulation | AXLK signaling pathway | Activation | hsa01521 | |
| In Vitro Model | Plasma | Blood | Homo sapiens (Human) | N.A. |
| Experiment for Molecule Alteration |
Circulating-free DNA assay; Whole exome sequencing assay | |||
| Mechanism Description | Quantification of allele fractions in plasma identified increased representation of mutant alleles in association with emergence of therapy resistance. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Ovarian cancer [ICD-11: 2C73.0] | [1] | |||
| Resistant Disease | Ovarian cancer [ICD-11: 2C73.0] | |||
| Resistant Drug | Paclitaxel | |||
| Molecule Alteration | Missense mutation | p.P55S |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Cell Pathway Regulation | AXLK signaling pathway | Activation | hsa01521 | |
| In Vitro Model | Plasma | Blood | Homo sapiens (Human) | N.A. |
| Experiment for Molecule Alteration |
Circulating-free DNA assay; Whole exome sequencing assay | |||
| Mechanism Description | Quantification of allele fractions in plasma identified increased representation of mutant alleles in association with emergence of therapy resistance. | |||
Investigative Drug(s)
2 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Ovarian cancer [ICD-11: 2C73.0] | [1] | |||
| Resistant Disease | Ovarian cancer [ICD-11: 2C73.0] | |||
| Resistant Drug | Carboplatin/Liposomal doxorubicin | |||
| Molecule Alteration | Missense mutation | p.P55S |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Cell Pathway Regulation | AXLK signaling pathway | Activation | hsa01521 | |
| In Vitro Model | Plasma | Blood | Homo sapiens (Human) | N.A. |
| Experiment for Molecule Alteration |
Circulating-free DNA assay; Whole exome sequencing assay | |||
| Mechanism Description | Quantification of allele fractions in plasma identified increased representation of mutant alleles in association with emergence of therapy resistance. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Ovarian cancer [ICD-11: 2C73.0] | [1] | |||
| Resistant Disease | Ovarian cancer [ICD-11: 2C73.0] | |||
| Resistant Drug | Carboplatin/Paclitaxel | |||
| Molecule Alteration | Missense mutation | p.P55S |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Cell Pathway Regulation | AXLK signaling pathway | Activation | hsa01521 | |
| In Vitro Model | Plasma | Blood | Homo sapiens (Human) | N.A. |
| Experiment for Molecule Alteration |
Circulating-free DNA assay; Whole exome sequencing assay | |||
| Mechanism Description | Quantification of allele fractions in plasma identified increased representation of mutant alleles in association with emergence of therapy resistance. | |||
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Ovary | |
| The Specified Disease | Ovarian cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.88E-03; Fold-change: -7.01E-01; Z-score: -1.78E+00 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 5.38E-01; Fold-change: 5.63E-02; Z-score: 8.75E-02 | |
|
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
