General Information of the Molecule (ID: Mol00323)
Name
Epithelial discoidin domain-containing receptor 1 (DDR1) ,Homo sapiens
Molecule Type
Protein
Gene Name
DDR1
Gene ID
780
Location
chr6:30876421-30900156[+]
Sequence
MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAAR
HSRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRL
RYSRDGRRWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRV
ELYGCLWRDGLLSYTAPVGQTMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGVVGLDD
FRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGG
VECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFS
EISFISDVVNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILI
GCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPRE
PPPYQEPRPRGNPPHSAPCVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNT
QAYSGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGP
PRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVSLDFPLNVRKGHPLLVAVKILRPD
ATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLED
KAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTI
KIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLC
RAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQ
LHRFLAEDALNTV
    Click to Show/Hide
3D-structure
PDB ID
6BRJ
Classification
Transferase/transferase inhibitor
Method
X-ray diffraction
Resolution
2.23  Å
Function
Tyrosine kinase that functions as cell surface receptor for fibrillar collagen and regulates cell attachment to the extracellular matrix, remodeling of the extracellular matrix, cell migration, differentiation, survival and cell proliferation. Collagen binding triggers a signaling pathway that involves SRC and leads to the activation of MAP kinases. Regulates remodeling of the extracellular matrix by up-regulation of the matrix metalloproteinases MMP2, MMP7 and MMP9, and thereby facilitates cell migration and wound healing. Required for normal blastocyst implantation during pregnancy, for normal mammary gland differentiation and normal lactation. Required for normal ear morphology and normal hearing (By similarity). Promotes smooth muscle cell migration, and thereby contributes to arterial wound healing. Also plays a role in tumor cell invasion. Phosphorylates PTPN11.
    Click to Show/Hide
Uniprot ID
DDR1_HUMAN
Ensembl ID
ENSG00000204580
HGNC ID
HGNC:2730
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  ADTT: Aberration of the Drug's Therapeutic Target
  UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
4 drug(s) in total
Click to Show/Hide the Full List of Drugs
Cisplatin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Ovarian cancer [ICD-11: 2C73.0] [2]
Resistant Disease Ovarian cancer [ICD-11: 2C73.0]
Resistant Drug Cisplatin
Molecule Alteration Expression
Down-regulation
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation miR199a/DDR1 signaling pathway Regulation N.A.
In Vitro Model SkOV3 cells Ovary Homo sapiens (Human) CVCL_0532
HO8910 cells Ovary Homo sapiens (Human) CVCL_6868
IOSE386 cells Ovary Homo sapiens (Human) CVCL_E230
Experiment for
Molecule Alteration
Western blot analysis; Immunohistochemistry assay; Luciferase assay
Experiment for
Drug Resistance
CCK8 assay; Flow cytometric analysis; Wound healing assay
Mechanism Description Suppressing miR199a-3p by promoter methylation contributes to tumor aggressiveness and cisplatin resistance of ovarian cancer through promoting DDR1 expression. Overexpression of miR199a-3p significantly impaired the migratory, invasive, and tumorigenic capabilities of ovarian cancer cells as well as enhanced cisplatin resistance through inhibiting DDR1 expression.
LY2835219
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Breast adenocarcinoma [ICD-11: 2C60.1] [1]
Resistant Disease Breast adenocarcinoma [ICD-11: 2C60.1]
Resistant Drug LY2835219
Molecule Alteration Expressiom
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation TFAP2C-DDR1 signaling pathway Regulation N.A.
In Vitro Model MCF7 cells Breast Homo sapiens (Human) CVCL_0031
Experiment for
Drug Resistance
IC50 assay
Mechanism Description The comprehensive analyses revealed DDR1 as a potential factor implicated in mediating resistance to CDK4/6i. Specifically, DDR1 inhibition in combination with palbociclib exhibited remarkable synergistic effects, reducing cell survival signaling and promoting apoptosis in resistant cells. In-vivo xenograft model further validated the synergistic effects, showing a significant reduction in the resistant tumor growth. Exploration into DDR1 activation uncovered TFAP2C as a key transcription factor regulating DDR1 expression in palbociclib resistant cells and inhibition of TFAP2C re-sensitized resistant cells to palbociclib. Gene set enrichment analysis (GSEA) in the NeoPalAna trial demonstrated a significant enrichment of the TFAP2C-DDR1 gene set from patitens after palbociclib treatment, suggesting the possible activation of the TFAP2C-DDR1 axis following palbociclib exposure.
Palbociclib
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Breast adenocarcinoma [ICD-11: 2C60.1] [1]
Resistant Disease Breast adenocarcinoma [ICD-11: 2C60.1]
Resistant Drug Palbociclib
Molecule Alteration Expressiom
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation TFAP2C-DDR1 signaling pathway Regulation N.A.
In Vitro Model T-47D cells N.A. Homo sapiens (Human) CVCL_0553
Experiment for
Drug Resistance
IC50 assay
Mechanism Description The comprehensive analyses revealed DDR1 as a potential factor implicated in mediating resistance to CDK4/6i. Specifically, DDR1 inhibition in combination with palbociclib exhibited remarkable synergistic effects, reducing cell survival signaling and promoting apoptosis in resistant cells. In-vivo xenograft model further validated the synergistic effects, showing a significant reduction in the resistant tumor growth. Exploration into DDR1 activation uncovered TFAP2C as a key transcription factor regulating DDR1 expression in palbociclib resistant cells and inhibition of TFAP2C re-sensitized resistant cells to palbociclib. Gene set enrichment analysis (GSEA) in the NeoPalAna trial demonstrated a significant enrichment of the TFAP2C-DDR1 gene set from patitens after palbociclib treatment, suggesting the possible activation of the TFAP2C-DDR1 axis following palbociclib exposure.
Disease Class: Breast adenocarcinoma [ICD-11: 2C60.1] [1]
Resistant Disease Breast adenocarcinoma [ICD-11: 2C60.1]
Resistant Drug Palbociclib
Molecule Alteration Expressiom
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation TFAP2C-DDR2 signaling pathway Regulation N.A.
In Vitro Model MCF7 cells Breast Homo sapiens (Human) CVCL_0031
Experiment for
Drug Resistance
IC50 assay
Mechanism Description The comprehensive analyses revealed DDR1 as a potential factor implicated in mediating resistance to CDK4/6i. Specifically, DDR1 inhibition in combination with palbociclib exhibited remarkable synergistic effects, reducing cell survival signaling and promoting apoptosis in resistant cells. In-vivo xenograft model further validated the synergistic effects, showing a significant reduction in the resistant tumor growth. Exploration into DDR1 activation uncovered TFAP2C as a key transcription factor regulating DDR1 expression in palbociclib resistant cells and inhibition of TFAP2C re-sensitized resistant cells to palbociclib. Gene set enrichment analysis (GSEA) in the NeoPalAna trial demonstrated a significant enrichment of the TFAP2C-DDR1 gene set from patitens after palbociclib treatment, suggesting the possible activation of the TFAP2C-DDR1 axis following palbociclib exposure.
Disease Class: Breast adenocarcinoma [ICD-11: 2C60.1] [1]
Resistant Disease Breast adenocarcinoma [ICD-11: 2C60.1]
Resistant Drug Palbociclib
Molecule Alteration Expressiom
Up-regulation
Experimental Note Discovered Using In-vivo Testing Model
Cell Pathway Regulation TFAP2C-DDR0 signaling pathway Regulation N.A.
In Vivo Model Breast cancer xenograft model Mus musculus
Experiment for
Drug Resistance
Tumor volume assay
Mechanism Description The comprehensive analyses revealed DDR1 as a potential factor implicated in mediating resistance to CDK4/6i. Specifically, DDR1 inhibition in combination with palbociclib exhibited remarkable synergistic effects, reducing cell survival signaling and promoting apoptosis in resistant cells. In-vivo xenograft model further validated the synergistic effects, showing a significant reduction in the resistant tumor growth. Exploration into DDR1 activation uncovered TFAP2C as a key transcription factor regulating DDR1 expression in palbociclib resistant cells and inhibition of TFAP2C re-sensitized resistant cells to palbociclib. Gene set enrichment analysis (GSEA) in the NeoPalAna trial demonstrated a significant enrichment of the TFAP2C-DDR1 gene set from patitens after palbociclib treatment, suggesting the possible activation of the TFAP2C-DDR1 axis following palbociclib exposure.
Ribociclib
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Breast adenocarcinoma [ICD-11: 2C60.1] [1]
Resistant Disease Breast adenocarcinoma [ICD-11: 2C60.1]
Resistant Drug Ribociclib
Molecule Alteration Expressiom
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation TFAP2C-DDR1 signaling pathway Regulation N.A.
In Vitro Model MCF7 cells Breast Homo sapiens (Human) CVCL_0031
Experiment for
Drug Resistance
IC50 assay
Mechanism Description The comprehensive analyses revealed DDR1 as a potential factor implicated in mediating resistance to CDK4/6i. Specifically, DDR1 inhibition in combination with palbociclib exhibited remarkable synergistic effects, reducing cell survival signaling and promoting apoptosis in resistant cells. In-vivo xenograft model further validated the synergistic effects, showing a significant reduction in the resistant tumor growth. Exploration into DDR1 activation uncovered TFAP2C as a key transcription factor regulating DDR1 expression in palbociclib resistant cells and inhibition of TFAP2C re-sensitized resistant cells to palbociclib. Gene set enrichment analysis (GSEA) in the NeoPalAna trial demonstrated a significant enrichment of the TFAP2C-DDR1 gene set from patitens after palbociclib treatment, suggesting the possible activation of the TFAP2C-DDR1 axis following palbociclib exposure.
References
Ref 1 TFAP2C-DDR1 axis regulates resistance to CDK4/6 inhibitor in breast cancer. Cancer Lett. 2025 Feb 1;610:217356.
Ref 2 Suppressing miR-199a-3p by promoter methylation contributes to tumor aggressiveness and cisplatin resistance of ovarian cancer through promoting DDR1 expression. J Ovarian Res. 2017 Jul 25;10(1):50. doi: 10.1186/s13048-017-0333-4.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.