Molecule Information

General Information of the Molecule (ID: Mol00303)

Name	Calpain small subunit 1 (CAPNS1) ,Homo sapiens
Synonyms	CSS1; Calcium-activated neutral proteinase small subunit; CANP small subunit; Calcium-dependent protease small subunit; CDPS; Calcium-dependent protease small subunit 1; Calpain regulatory subunit; CAPN4; CAPNS Click to Show/Hide
Molecule Type	Protein
Gene Name	CAPNS1
Gene ID	826
Location	chr19:36139953-36150353[+]
Sequence	MFLVNSFLKGGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMR ILGGVISAISEAAAQYNPEPPPPRTHYSNIEANESEEVRQFRRLFAQLAGDDMEVSATEL MNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQ FDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMF RAFKSLDKDGTGQIQVNIQEWLQLTMYS Click to Show/Hide
Function	Regulatory subunit of the calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. Essential for embryonic development (By similarity). Click to Show/Hide
Uniprot ID	CPNS1_HUMAN
Ensembl ID	ENSG00000126247
HGNC ID	HGNC:1481
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Cisplatin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Gastric cancer				[1]
Resistant Disease	Gastric cancer [ICD-11: 2B72.1]			Disease Info
Resistant Drug	Cisplatin			Drug Info
Molecule Alteration	Expression		Down-regulation
Experimental Note	Revealed Based on the Cell Line Data
In Vitro Model	BGC-823 cells	Gastric	Homo sapiens (Human)	CVCL_3360
	SGC7901 cells	Gastric	Homo sapiens (Human)	CVCL_0520
Experiment for Molecule Alteration	Western blot analysis
Experiment for Drug Resistance	TUNEL assay; Clonogenic assay
Mechanism Description	Inhibition of miR99a and miR491, or overexpress CAPNS1 can enhance cisplatin sensitivity of the resistant cells. miR99a and miR491 might be work as novel molecules regulate cisplatin resistance by directly targeting CAPNS1 associated pathway in human gastric cancer cells.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Click to Show/Hide the Resistance Disease of This Class

Gastric cancer [ICD-11: 2B72]

Click to Show/Hide

Differential expression of molecule in resistant diseases
The Studied Tissue	Gastric tissue
The Specified Disease	Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.19E-02; Fold-change: 7.81E-02; Z-score: 4.25E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.66E-03; Fold-change: 1.93E+00; Z-score: 1.74E+00
Molecule expression in the normal tissue adjacent to the diseased tissue of patients Molecule expression in the diseased tissue of patients Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances		Click to View the Clearer Original Diagram
Download Molecule expression barchart for all samples Download Molecule expression data of patients in the normal section of the tissue adjacent to the disease section Download Molecule expression data of patients in the disease section of the tissue Download Molecule expression data in the tissue of healthy individual

Tissue-specific Molecule Abundances in Healthy Individuals

Click to Show/Hide the Molecule Abundances


Download the Tissue-Specific Variation(s) Profile

References

Ref 1	MiR-99a and MiR-491 Regulate Cisplatin Resistance in Human Gastric Cancer Cells by Targeting CAPNS1. Int J Biol Sci. 2016 Nov 5;12(12):1437-1447. doi: 10.7150/ijbs.16529. eCollection 2016.