Molecule Information

General Information of the Molecule (ID: Mol00299)

• Name: Solute carrier family 31 member 1 (SLC31A1) ,Homo sapiens
• Synonyms: Copper transporter 1; hCTR1; Solute carrier family 31 member 1; COPT1; CTR1
• Molecule Type: Protein
• Gene Name: SLC31A1
• Gene ID: 1317
• Location: chr9:113221544-113264492[+]
• Sequence:
  MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSG
  LVINTAGEMAGAFVAVFLLAMFYEGLKIARESLLRKSQVSIRYNSMPVPGPNGTILMETH
  KTVGQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKA
  VVVDITEHCH
• 3D-structure: PDB ID: 2LS3; Classification: Metal transport; Method: Solution nmr; Resolution: No Resolution Dat Å
• Function: High-affinity, saturable copper transporter involved in dietary copper uptake.
• Uniprot ID: COPT1_HUMAN
• Ensembl ID: ENSG00000136868
• HGNC ID: HGNC:11016

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Cisplatin

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Lung cancer [ICD-11: 2C25.5] [1]

• Sensitive Disease: Lung cancer [ICD-11: 2C25.5]
• Sensitive Drug: Cisplatin
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• Cell Pathway Regulation: Cell proliferation; Inhibition; hsa05200
• Cell Pathway Regulation: Ubiquitin-proteasome signaling pathway; Regulation; N.A.
• In Vitro Model: H460 cells; Lung; Homo sapiens (Human); CVCL_0459
• In Vitro Model: H1299 cells; Lung; Homo sapiens (Human); CVCL_0060
• In Vitro Model: A459 cells; Lung; Homo sapiens (Human); CVCL_0023
• Experiment for Molecule Alteration: Western blot analysis
• Experiment for Drug Resistance: MTT assay
• Mechanism Description: NEAT1 may act as a competing endogenous LncRNA to upregulate EGCG-induced CTR1 by sponging hsa-mir-98-5p to upregulates EGCG-induced CTR1 to enhance cisplatin sensitivity in lung cancer cells.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Lung cancer [ICD-11: 2C25]

Differential expression of molecule in resistant diseases

• The Studied Tissue: Lung
• The Specified Disease: Lung cancer
• The Expression Level of Disease Section Compare with the Healthy Individual Tissue: p-value: 8.17E-14; Fold-change: -2.70E-01; Z-score: -4.89E-01
• The Expression Level of Disease Section Compare with the Adjacent Tissue: p-value: 1.62E-02; Fold-change: 9.46E-02; Z-score: 2.43E-01

References

• Ref 1: NEAT1 upregulates EGCG-induced CTR1 to enhance cisplatin sensitivity in lung cancer cells. Oncotarget. 2016 Jul 12;7(28):43337-43351. doi: 10.18632/oncotarget.9712.