Molecule Information
General Information of the Molecule (ID: Mol00230)
Name |
Phorbol-12-myristate-13-acetate-induced protein 1 (PMAIP1)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
PMA-induced protein 1; Immediate-early-response protein APR; Protein Noxa; NOXA
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
PMAIP1
|
||||
Gene ID | |||||
Location |
chr18:59899996-59904305[+]
|
||||
Sequence |
MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
Click to Show/Hide
|
||||
Function |
Promotes activation of caspases and apoptosis. Promotes mitochondrial membrane changes and efflux of apoptogenic proteins from the mitochondria. Contributes to p53/TP53-dependent apoptosis after radiation exposure. Promotes proteasomal degradation of MCL1. Competes with BAK1 for binding to MCL1 and can displace BAK1 from its binding site on MCL1 (By similarity). Competes with BIM/BCL2L11 for binding to MCL1 and can displace BIM/BCL2L11 from its binding site on MCL1.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Breast cancer | [1] | |||
Resistant Disease | Breast cancer [ICD-11: 2C60.3] | |||
Resistant Drug | Cisplatin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
In Vitro Model | MCF-7 cells | Breast | Homo sapiens (Human) | CVCL_0031 |
ZR75-1 cells | Breast | Homo sapiens (Human) | CVCL_0588 | |
MCF-7R cells | Breast | Homo sapiens (Human) | CVCL_Y493 | |
ZR-75-1R cells | Breast | Homo sapiens (Human) | CVCL_0588 | |
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
Annexin V apoptosis assay; Fow cytometry analysis | |||
Mechanism Description | LncRNA H19 attenuated cell apoptosis in response to PTX treatment by inhibiting transcription of pro-apoptotic genes BIk and NOXA. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Breast cancer | [1] | |||
Resistant Disease | Breast cancer [ICD-11: 2C60.3] | |||
Resistant Drug | Epirubicin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
In Vitro Model | MCF-7 cells | Breast | Homo sapiens (Human) | CVCL_0031 |
ZR75-1 cells | Breast | Homo sapiens (Human) | CVCL_0588 | |
MCF-7R cells | Breast | Homo sapiens (Human) | CVCL_Y493 | |
ZR-75-1R cells | Breast | Homo sapiens (Human) | CVCL_0588 | |
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
Annexin V apoptosis assay; Fow cytometry analysis | |||
Mechanism Description | LncRNA H19 attenuated cell apoptosis in response to PTX treatment by inhibiting transcription of pro-apoptotic genes BIk and NOXA. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Breast cancer | [1] | |||
Resistant Disease | Breast cancer [ICD-11: 2C60.3] | |||
Resistant Drug | Paclitaxel | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
In Vitro Model | MCF-7 cells | Breast | Homo sapiens (Human) | CVCL_0031 |
ZR75-1 cells | Breast | Homo sapiens (Human) | CVCL_0588 | |
MCF-7R cells | Breast | Homo sapiens (Human) | CVCL_Y493 | |
ZR-75-1R cells | Breast | Homo sapiens (Human) | CVCL_0588 | |
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
Annexin V apoptosis assay; Fow cytometry analysis | |||
Mechanism Description | LncRNA H19 attenuated cell apoptosis in response to PTX treatment by inhibiting transcription of pro-apoptotic genes BIk and NOXA. | |||
Disease Class: ER positive breast cancer | [1] | |||
Resistant Disease | ER positive breast cancer [ICD-11: 2C60.6] | |||
Resistant Drug | Paclitaxel | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
In Vitro Model | MCF-7 cells | Breast | Homo sapiens (Human) | CVCL_0031 |
ZR75-1 cells | Breast | Homo sapiens (Human) | CVCL_0588 | |
MCF-7R cells | Breast | Homo sapiens (Human) | CVCL_Y493 | |
ZR-75-1R cells | Breast | Homo sapiens (Human) | CVCL_0588 | |
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
Annexin V apoptosis assay; Fow cytometry analysis | |||
Mechanism Description | LncRNA H19 attenuated cell apoptosis in response to PTX treatment by inhibiting transcription of pro-apoptotic genes BIk and NOXA. |
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Breast tissue | |
The Specified Disease | Breast cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.99E-79; Fold-change: 1.60E+00; Z-score: 1.72E+00 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 2.76E-10; Fold-change: 9.50E-01; Z-score: 9.61E-01 | |
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
![]() |
||
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.