Molecule Information
General Information of the Molecule (ID: Mol00212)
| Name |
Activin receptor-like kinase 7 (ALK7)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
Activin receptor type IC; ACTR-IC; Activin receptor-like kinase 7; ALK-7; ALK7
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
ACVR1C
|
||||
| Gene ID | |||||
| Location |
chr2:157526767-157628864[-]
|
||||
| Sequence |
MTRALCSALRQALLLLAAAAELSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVI
KSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITV PVCLLSIAAMLTVWACQGRQCSYRKKKRPNVEEPLSECNLVNAGKTLKDLIYDVTASGSG SGLPLLVQRTIARTIVLQEIVGKGRFGEVWHGRWCGEDVAVKIFSSRDERSWFREAEIYQ TVMLRHENILGFIAADNKDNGTWTQLWLVSEYHEQGSLYDYLNRNIVTVAGMIKLALSIA SGLAHLHMEIVGTQGKPAIAHRDIKSKNILVKKCETCAIADLGLAVKHDSILNTIDIPQN PKVGTKRYMAPEMLDDTMNVNIFESFKRADIYSVGLVYWEIARRCSVGGIVEEYQLPYYD MVPSDPSIEEMRKVVCDQKFRPSIPNQWQSCEALRVMGRIMRECWYANGAARLTALRIKK TISQLCVKEDCKA Click to Show/Hide
|
||||
| Function |
Serine/threonine protein kinase which forms a receptor complex on ligand binding. The receptor complex consisting of 2 type II and 2 type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators, SMAD2 and SMAD3. Receptor for activin AB, activin B and NODAL. Plays a role in cell differentiation, growth arrest and apoptosis.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Ovarian cancer [ICD-11: 2C73.0] | [1] | |||
| Resistant Disease | Ovarian cancer [ICD-11: 2C73.0] | |||
| Resistant Drug | Cisplatin | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Differential expression of the molecule in resistant disease | ||||
| Classification of Disease | Ovarian cancer [ICD-11: 2C73] | |||
| The Specified Disease | Ovarian cancer | |||
| The Studied Tissue | Ovarian tissue | |||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.94E-01 Fold-change: -1.00E-01 Z-score: -1.42E+00 |
|||
| Experimental Note | Identified from the Human Clinical Data | |||
| Cell Pathway Regulation | Cell proliferation | Activation | hsa05200 | |
| Nodal/ALK7 signaling pathway | Inhibition | hsa04350 | ||
| In Vitro Model | A2780s cells | Ovary | Homo sapiens (Human) | CVCL_4863 |
| OV2008 cells | Ovary | Homo sapiens (Human) | CVCL_0473 | |
| Experiment for Molecule Alteration |
Luciferase reporter assay | |||
| Experiment for Drug Resistance |
WST-1 assay | |||
| Mechanism Description | We found that miR-376c increased cell proliferation and survival, as well as spheroid formation, in part by targeting ALk7. We have also provided evidence that the Nodal-ALk7 pathway is involved in cisplatin-induced ovarian cancer cell death and that miR-376c might promote chemoresistance. | |||
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Ovary | |
| The Specified Disease | Ovarian cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.94E-01; Fold-change: -5.38E-01; Z-score: -7.39E-01 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.30E-06; Fold-change: 3.89E-01; Z-score: 1.50E+00 | |
|
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
