Molecule Information
General Information of the Molecule (ID: Mol00210)
| Name |
Solute carrier family 21 member 8 (SLC21A8)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
Liver-specific organic anion transporter 2; LST-2; Organic anion transporter 8; Organic anion-transporting polypeptide 8; OATP-8; Solute carrier family 21 member 8; LST2; OATP1B3; OATP8; SLC21A8
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
SLCO1B3
|
||||
| Gene ID | |||||
| Location |
chr12:20810702-20916911[+]
|
||||
| Sequence |
MDQHQHLNKTAESASSEKKKTRRCNGFKMFLAALSFSYIAKALGGIIMKISITQIERRFD
ISSSLAGLIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCLLMGTGSILTSLPHFFMGY YRYSKETHINPSENSTSSLSTCLINQTLSFNGTSPEIVEKDCVKESGSHMWIYVFMGNML RGIGETPIVPLGISYIDDFAKEGHSSLYLGSLNAIGMIGPVIGFALGSLFAKMYVDIGYV DLSTIRITPKDSRWVGAWWLGFLVSGLFSIISSIPFFFLPKNPNKPQKERKISLSLHVLK TNDDRNQTANLTNQGKNVTKNVTGFFQSLKSILTNPLYVIFLLLTLLQVSSFIGSFTYVF KYMEQQYGQSASHANFLLGIITIPTVATGMFLGGFIIKKFKLSLVGIAKFSFLTSMISFL FQLLYFPLICESKSVAGLTLTYDGNNSVASHVDVPLSYCNSECNCDESQWEPVCGNNGIT YLSPCLAGCKSSSGIKKHTVFYNCSCVEVTGLQNRNYSAHLGECPRDNTCTRKFFIYVAI QVINSLFSATGGTTFILLTVKIVQPELKALAMGFQSMVIRTLGGILAPIYFGALIDKTCM KWSTNSCGAQGACRIYNSVFFGRVYLGLSIALRFPALVLYIVFIFAMKKKFQGKDTKASD NERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAAN Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
Mediates the Na(+)-independent uptake of organic anions such as 17-beta-glucuronosyl estradiol, taurocholate, triiodothyronine (T3), leukotriene C4, dehydroepiandrosterone sulfate (DHEAS), methotrexate and sulfobromophthalein (BSP). Involved in the clearance of bile acids and organic anions from the liver.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Hyperlipidemia [ICD-11: 5C80.Z] | [1] | |||
| Sensitive Disease | Hyperlipidemia [ICD-11: 5C80.Z] | |||
| Sensitive Drug | Rosuvastatin | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Differential expression of the molecule in resistant disease | ||||
| Classification of Disease | Hyperlipoproteinaemia [ICD-11: 5C80] | |||
| The Specified Disease | Familial hypercholesterolemia | |||
| The Studied Tissue | Whole blood | |||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.65E-01 Fold-change: -3.04E-02 Z-score: -1.48E+00 |
|||
| Experimental Note | Identified from the Human Clinical Data | |||
| Mechanism Description | Enasidenib (and its metabolite, AGI-16903) at clinically relevant concentrations has effects on multiple drug metabolic enzymes and transporters, including inhibition of P-gp, BCRP, OATP1B1, and OATP1B3 transporters. When a single dose of rosuvastatin was administered together with 28 days of dosing of enasidenib, the AUC0-30 and AUC0-inf of rosuvastatin increased by =249% and 244%, respectively; and the Cmax increased by 366%, when compared to the single dose of rosuvastatin administered alone. | |||
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 05
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Whole blood | |
| The Specified Disease | Familial hypercholesterolemia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.65E-01; Fold-change: -6.07E-02; Z-score: -3.77E-01 | |
|
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
|
||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
