Molecule Information
General Information of the Molecule (ID: Mol00209)
| Name |
Solute carrier family 21 member 6 (SLC21A6)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
Liver-specific organic anion transporter 1; LST-1; OATP-C; Sodium-independent organic anion-transporting polypeptide 2; OATP-2; Solute carrier family 21 member 6; LST1; OATP1B1; OATP2; OATPC; SLC21A6
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
SLCO1B1
|
||||
| Gene ID | |||||
| Location |
chr12:21131194-21239796[+]
|
||||
| Sequence |
MDQNQHLNKTAEAQPSENKKTRYCNGLKMFLAALSLSFIAKTLGAIIMKSSIIHIERRFE
ISSSLVGFIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCFIMGIGGVLTALPHFFMGY YRYSKETNINSSENSTSTLSTCLINQILSLNRASPEIVGKGCLKESGSYMWIYVFMGNML RGIGETPIVPLGLSYIDDFAKEGHSSLYLGILNAIAMIGPIIGFTLGSLFSKMYVDIGYV DLSTIRITPTDSRWVGAWWLNFLVSGLFSIISSIPFFFLPQTPNKPQKERKASLSLHVLE TNDEKDQTANLTNQGKNITKNVTGFFQSFKSILTNPLYVMFVLLTLLQVSSYIGAFTYVF KYVEQQYGQPSSKANILLGVITIPIFASGMFLGGYIIKKFKLNTVGIAKFSCFTAVMSLS FYLLYFFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGIT YISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFFVAI QVLNLFFSALGGTSHVMLIVKIVQPELKSLALGFHSMVIRALGGILAPIYFGALIDTTCI KWSTNNCGTRGSCRTYNSTSFSRVYLGLSSMLRVSSLVLYIILIYAMKKKYQEKDINASE NGSVMDEANLESLNKNKHFVPSAGADSETHC Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
Mediates the Na(+)-independent uptake of organic anions such as pravastatin, taurocholate, methotrexate, dehydroepiandrosterone sulfate, 17-beta-glucuronosyl estradiol, estrone sulfate, prostaglandin E2, thromboxane B2, leukotriene C3, leukotriene E4, thyroxine and triiodothyronine. Involved in the clearance of bile acids and organic anions from the liver.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Hyperlipidemia [ICD-11: 5C80.Z] | [1] | |||
| Sensitive Disease | Hyperlipidemia [ICD-11: 5C80.Z] | |||
| Sensitive Drug | Rosuvastatin | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Differential expression of the molecule in resistant disease | ||||
| Classification of Disease | Hyperlipoproteinaemia [ICD-11: 5C80] | |||
| The Specified Disease | Familial hypercholesterolemia | |||
| The Studied Tissue | Whole blood | |||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.27E-01 Fold-change: -2.34E-02 Z-score: -1.02E+00 |
|||
| Experimental Note | Identified from the Human Clinical Data | |||
| Mechanism Description | Enasidenib (and its metabolite, AGI-16903) at clinically relevant concentrations has effects on multiple drug metabolic enzymes and transporters, including inhibition of P-gp, BCRP, OATP1B1, and OATP1B3 transporters. When a single dose of rosuvastatin was administered together with 28 days of dosing of enasidenib, the AUC0-30 and AUC0-inf of rosuvastatin increased by =249% and 244%, respectively; and the Cmax increased by 366%, when compared to the single dose of rosuvastatin administered alone. | |||
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 05
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Whole blood | |
| The Specified Disease | Familial hypercholesterolemia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.27E-01; Fold-change: -5.78E-02; Z-score: -3.84E-01 | |
|
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
|
||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
