Molecule Information

General Information of the Molecule (ID: Mol00189)

• Name: Thyroid receptor-interacting protein 6 (TRIP6) ,Homo sapiens
• Synonyms: TR-interacting protein 6; TRIP-6; Opa-interacting protein 1; OIP-1; Zyxin-related protein 1; ZRP-1; OIP1
• Molecule Type: Protein
• Gene Name: TRIP6
• Gene ID: 7205
• Location: chr7:100867387-100873454[+]
• Sequence:
  MSGPTWLPPKQPEPARAPQGRAIPRGTPGPPPAHGAALQPHPRVNFCPLPSEQCYQAPGG
  PEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDR
  QAYEPPPPPAYRTGSLKPNPASPLPASPYGGPTPASYTTASTPAGPAFPVQVKVAQPVRG
  CGPPRRGASQASGPLPGPHFPLPGRGEVWGPGYRSQREPGPGAKEEAAGVSGPAGRGRGG
  EHGPQVPLSQPPEDELDRLTKKLVHDMNHPPSGEYFGQCGGCGEDVVGDGAGVVALDRVF
  HVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVATLEKCATCSQPILDRILRAMGKAYHP
  GCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVA
  LDRSFHIGCYKCEECGLLLSSEGECQGCYPLDGHILCKACSAWRIQELSATVTTDC
• 3D-structure: PDB ID: 2DLO; Classification: Cell adhesion; Method: Solution nmr; Resolution: No Resolution Dat Å
• Function: Relays signals from the cell surface to the nucleus to weaken adherens junction and promote actin cytoskeleton reorganization and cell invasiveness. Involved in lysophosphatidic acid-induced cell adhesion and migration. Acts as a transcriptional coactivator for NF-kappa-B and JUN, and mediates the transrepression of these transcription factors induced by glucocorticoid receptor.
• Uniprot ID: TRIP6_HUMAN
• Ensembl ID: ENSG00000087077
• HGNC ID: HGNC:12311

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  EADR: Epigenetic Alteration of DNA, RNA or Protein

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Pazopanib HCl

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Epigenetic Alteration of DNA, RNA or Protein (EADR)

Disease Class: Synovial sarcoma [ICD-11: 2B5A.0] [1]

• Resistant Disease: Synovial sarcoma [ICD-11: 2B5A.0]
• Resistant Drug: Pazopanib HCl
• Molecule Alteration: Expression; Down-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• In Vitro Model: 1273/99 cells; Sarcoma; Homo sapiens (Human); CVCL_N588
• In Vitro Model: HS-SYII cells; Sarcoma; Homo sapiens (Human); CVCL_8719
• In Vitro Model: SYO-1 cells; Sarcoma; Homo sapiens (Human); CVCL_7146
• In Vitro Model: YaFuSS cells; Sarcoma; Homo sapiens (Human); CVCL_L809
• Experiment for Molecule Alteration: qRT-PCR
• Experiment for Drug Resistance: EV isolation, immunoblotting, and nanoparticle tracking analysis
• Mechanism Description: Extracellular vesicle-encapsulated microRNA-761 enhances pazopanib resistance in synovial sarcoma by down-regulating TRIP6, LMNA, and SIRT3 expression.

References

• Ref 1: Extracellular vesicle-encapsulated microRNA-761 enhances pazopanib resistance in synovial sarcoma. Biochem Biophys Res Commun. 2018 Jan 1;495(1):1322-1327. doi: 10.1016/j.bbrc.2017.11.164. Epub 2017 Nov 27.