General Information of the Molecule (ID: Mol00185)
Name
Tumor protein D52 (TPD52) ,Homo sapiens
Synonyms
Protein N8
    Click to Show/Hide
Molecule Type
Protein
Gene Name
TPD52
Gene ID
7163
Location
chr8:80034745-80231232[-]
Sequence
MDCREMDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKFGLLRTDPVPEEGED
VAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELK
QNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEK
VENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL
    Click to Show/Hide
Uniprot ID
TPD52_HUMAN
Ensembl ID
ENSG00000076554
HGNC ID
HGNC:12005
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Paclitaxel
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Breast cancer [ICD-11: 2C60.3] [1]
Resistant Disease Breast cancer [ICD-11: 2C60.3]
Resistant Drug Paclitaxel
Molecule Alteration Expression
Up-regulation
Differential expression of the molecule in resistant disease
Classification of Disease Breast cancer [ICD-11: 2C60]
The Specified Disease Breast cancer
The Studied Tissue Breast tissue
The Expression Level of Disease Section Compare with the Healthy Individual Tissue
p-value: 8.37E-86
Fold-change: 2.99E-01
Z-score: 2.53E+01
Experimental Note Identified from the Human Clinical Data
Cell Pathway Regulation Cell apoptosis Inhibition hsa04210
Wnt/Beta-catenin signaling pathway Activation hsa04310
In Vitro Model MCF-7 cells Breast Homo sapiens (Human) CVCL_0031
Experiment for
Molecule Alteration
Western blot analysis; RT-qPCR
Experiment for
Drug Resistance
MTT assay
Mechanism Description miR-107 could enhance PTX sensitivity in breast cancer cells may be targeting TPD52 through Wnt/beta-catenin signaling pathway. And downregualtion of miR-107 ould enhance PTX resistance in BC cells.
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Click to Show/Hide the Resistance Disease of This Class
Breast cancer [ICD-11: 2C60]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Breast tissue
The Specified Disease Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 8.37E-86; Fold-change: 1.65E+00; Z-score: 1.58E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 4.90E-12; Fold-change: 1.37E+00; Z-score: 1.23E+00
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Tissue-specific Molecule Abundances in Healthy Individuals
Click to Show/Hide the Molecule Abundances
References
Ref 1 miR-107 Enhances the Sensitivity of Breast Cancer Cells to Paclitaxel. Open Med (Wars). 2019 Jun 1;14:456-466. doi: 10.1515/med-2019-0049. eCollection 2019.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.