Molecule Information
General Information of the Molecule (ID: Mol00184)
Name |
T-LAK cell-originated protein kinase(PBK)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
Cancer/testis antigen 84; CT84; MAPKK-like protein kinase; Nori-3; PDZ-binding kinase; Spermatogenesis-related protein kinase; SPK; T-LAK cell-originated protein kinase; TOPK
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
PBK
|
||||
Gene ID | |||||
Location |
chr8:27809624-27838082[-]
|
||||
Sequence |
MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSP
WAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGE KSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFE TIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEM MTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVC TNEDPKDRPSAAHIVEALETDV Click to Show/Hide
|
||||
Function |
Phosphorylates MAP kinase p38. Seems to be active only in mitosis. May also play a role in the activation of lymphoid cells. When phosphorylated, forms a complex with TP53, leading to TP53 destabilization and attenuation of G2/M checkpoint during doxorubicin-induced DNA damage.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Colorectal cancer | [1] | |||
Resistant Disease | Colorectal cancer [ICD-11: 2B91.1] | |||
Resistant Drug | Oxaliplatin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | PI3K/PTEN/AKT signaling pathway | Regulation | hsa04151 | |
In Vitro Model | HT29 Cells | Colon | Homo sapiens (Human) | CVCL_A8EZ |
SW480 cells | Colon | Homo sapiens (Human) | CVCL_0546 | |
SW620 cells | Colon | Homo sapiens (Human) | CVCL_0547 | |
HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |
LOVO cells | Colon | Homo sapiens (Human) | CVCL_0399 | |
HCT8 cells | Colon | Homo sapiens (Human) | CVCL_2478 | |
COLO 205 cells | Colon | Homo sapiens (Human) | CVCL_0218 | |
CCD-18Co cells | Colon | Homo sapiens (Human) | CVCL_2379 | |
COLO-678 cells | Colon | Homo sapiens (Human) | CVCL_1129 | |
HT55 cells | Colon | Homo sapiens (Human) | CVCL_1294 | |
LS1034 cells | Colon | Homo sapiens (Human) | CVCL_1382 | |
SW1417 cells | Colon | Homo sapiens (Human) | CVCL_1717 | |
SW403 cells | Colon | Homo sapiens (Human) | CVCL_0545 | |
SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | |
In Vivo Model | BALB/c mouse xenograft model | Mus musculus | ||
Experiment for Molecule Alteration |
Luciferase activity assay; Western blot analysis | |||
Experiment for Drug Resistance |
CCK8 assay | |||
Mechanism Description | miR-216b promotes cell growth and enhances chemosensitivity of colorectal cancer by suppressing PDZ-binding kinase. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.