Molecule Information
General Information of the Molecule (ID: Mol00177)
Name |
Testis development-related protein 1 (TDRG1)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Molecule Type |
Protein
|
||||
Gene Name |
TDRG1
|
||||
Sequence |
MKRREAVCAHRHFLGTGKPPHPLGRSIPVEPCPGLPAFAEVDLLSLLVPIKISSTPPSGS
RLDPQIASSAFPGLGSLGGQDSSGSLVQRASCELESPYEL Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Seminoma | [1] | |||
Resistant Disease | Seminoma [ICD-11: 2C80.3] | |||
Resistant Drug | Cisplatin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
Cell proliferation | Activation | hsa05200 | ||
PI3K/AKT/mTOR signaling pathway | Regulation | hsa04151 | ||
In Vitro Model | TCam-2 cells | Testicle | Homo sapiens (Human) | CVCL_T012 |
In Vivo Model | Nude mouse xenograft model | Mus musculus | ||
Experiment for Molecule Alteration |
Western blot analysis; RT-qPCR | |||
Experiment for Drug Resistance |
MTT assay; Flow cytometry assay | |||
Mechanism Description | Long non-coding RNA H19 promotes TDRG1 expression and cisplatin resistance by sequestering miRNA-106b-5p in seminoma. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.