Molecule Information

General Information of the Molecule (ID: Mol00149)

• Name: Ras-related protein Rab-6A (RAP6A) ,Homo sapiens
• Synonyms: Rab-6; RAB6
• Molecule Type: Protein
• Gene Name: RAB6A
• Gene ID: 5870
• Location: chr11:73675638-73761137[-]
• Sequence:
  MSTGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDR
  TVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVI
  IMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMEST
  QDRSREDMIDIKLEKPQEQPVSEGGCSC
• 3D-structure: PDB ID: 1YZQ; Classification: Protein transport; Method: X-ray diffraction; Resolution: 1.78 Å
• Function: Protein transport. Regulator of membrane traffic from the Golgi apparatus towards the endoplasmic reticulum (ER). Has a low GTPase activity. Involved in COPI-independent retrograde transport from the Golgi to the ER.
• Uniprot ID: RAB6A_HUMAN
• Ensembl ID: ENSG00000175582
• HGNC ID: HGNC:9786

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Cisplatin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Lung cancer [ICD-11: 2C25.5] [1]

• Resistant Disease: Lung cancer [ICD-11: 2C25.5]
• Resistant Drug: Cisplatin
• Molecule Alteration: Expression; Down-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• Cell Pathway Regulation: Mitochondrial apoptotic signaling pathway; Activation; hsa04210
• In Vitro Model: A549 cells; Lung; Homo sapiens (Human); CVCL_0023
• In Vitro Model: H1299 cells; Lung; Homo sapiens (Human); CVCL_0060
• Experiment for Molecule Alteration: Western blot analysis; Luciferase reporter activity assay
• Experiment for Drug Resistance: CD44/CD133 assay; MTT assay
• Mechanism Description: miR5100 increases the cisplatin resistance of the lung cancer stem cells by inhibiting the Rab6. miR5100 increases cisplatin resistance via the mitochondrial apoptosis pathway.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Lung cancer [ICD-11: 2C25]

Differential expression of molecule in resistant diseases

• The Studied Tissue: Lung
• The Specified Disease: Lung cancer
• The Expression Level of Disease Section Compare with the Healthy Individual Tissue: p-value: 3.84E-63; Fold-change: 2.16E-01; Z-score: 1.26E+00
• The Expression Level of Disease Section Compare with the Adjacent Tissue: p-value: 7.60E-15; Fold-change: 1.71E-01; Z-score: 5.24E-01

References

• Ref 1: MiR-5100 increases the cisplatin resistance of the lung cancer stem cells by inhibiting the Rab6. Mol Carcinog. 2018 Mar;57(3):419-428. doi: 10.1002/mc.22765. Epub 2017 Dec 1.