Molecule Information
General Information of the Molecule (ID: Mol00148)
| Name |
Ras-related protein Rab-12 (RAB12)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Molecule Type |
Protein
|
||||
| Gene Name |
RAB12
|
||||
| Gene ID | |||||
| Location |
chr18:8609437-8639383[+]
|
||||
| Sequence |
MDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLME
RFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIIL VYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGM RFCEASAKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELPPPRPH VRCC Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab may play a role in protein transport from recycling endosomes to lysosomes regulating, for instance, the degradation of the transferrin receptor. Involved in autophagy (By similarity).
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Gastric cancer [ICD-11: 2B72.1] | [1] | |||
| Resistant Disease | Gastric cancer [ICD-11: 2B72.1] | |||
| Resistant Drug | Cisplatin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Differential expression of the molecule in resistant disease | ||||
| Classification of Disease | Gastric cancer [ICD-11: 2B72] | |||
| The Specified Disease | Gastric cancer | |||
| The Studied Tissue | Gastric tissue | |||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 9.79E-01 Fold-change: 8.96E-04 Z-score: 2.99E-02 |
|||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | SGC7901 cells | Gastric | Homo sapiens (Human) | CVCL_0520 |
| BGC823 cells | Gastric | Homo sapiens (Human) | CVCL_3360 | |
| BGC823CDDP cells | Gastric | Homo sapiens (Human) | CVCL_3360 | |
| SGC7901CDDP cells | Gastric | Homo sapiens (Human) | CVCL_0520 | |
| In Vivo Model | Nude mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Luciferase reporter assay; Western blot analysis | |||
| Experiment for Drug Resistance |
CCK8 assay; PI/Annexin V-FITC Apoptosis Detection kit assay | |||
| Mechanism Description | miR148a-3p reconstitution sensitized CDDP-resistant cells to CDDP treatment through promoting mitochondrial fission and decreasing AkAP1 expression level; miR148a-3p reconstitution in CDDP-resistant cells inhibits the cyto-protective autophagy by suppressing RAB12 expression and mTOR1 activation. miR148a-3p sensitization of GC cells to CDDP in vivo includes suppression of AkAP1 and RAB12 expression levels. | |||
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Gastric tissue | |
| The Specified Disease | Gastric cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 9.79E-01; Fold-change: 1.15E-01; Z-score: 4.75E-01 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.00E-04; Fold-change: -7.99E-01; Z-score: -1.44E+00 | |
|
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
