Molecule Information
General Information of the Molecule (ID: Mol00060)
| Name |
Endothelin-1 receptor (EDNRA)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
Endothelin receptor type A; ET-A; ETA-R; hET-AR; ETA; ETRA
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
EDNRA
|
||||
| Gene ID | |||||
| Location |
chr4:147480917-147544954[+]
|
||||
| Sequence |
METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLP
SNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA SLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALS VDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCM LNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATM NSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRS SHKDSMN Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Ovarian cancer [ICD-11: 2C73.0] | [1] | |||
| Sensitive Disease | Ovarian cancer [ICD-11: 2C73.0] | |||
| Sensitive Drug | Cisplatin | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Differential expression of the molecule in resistant disease | ||||
| Classification of Disease | Ovarian cancer [ICD-11: 2C73] | |||
| The Specified Disease | Ovarian cancer | |||
| The Studied Tissue | Ovarian tissue | |||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.79E-06 Fold-change: -5.92E-01 Z-score: -1.16E+01 |
|||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | AKT/MAPK signaling pathway | Inhibition | hsa04010 | |
| Cell invasion | Inhibition | hsa05200 | ||
| Cell proliferation | Inhibition | hsa05200 | ||
| In Vitro Model | HEY cells | Ovary | Homo sapiens (Human) | CVCL_0297 |
| A2780 cells | Ovary | Homo sapiens (Human) | CVCL_0134 | |
| OVCA433 cells | Ovary | Homo sapiens (Human) | CVCL_0475 | |
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
Trypan blue dye exclusion method assay; Transwell assay | |||
| Mechanism Description | Overexpression of miR-30a decreases cellular vitality, invasion, plasticity and EMT. ETAR is identified as a direct target of miR-30a, and their expression is inversely correlated in EOC cell lines and human tissue samples. Upregulation of miR-30a re-sensitizes resistant EOC cells to cisplatinum by binding ETAR. Overexpression of miR-30a inhibits tumor growth in cisplatinum-resistant xenografts. | |||
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Ovary | |
| The Specified Disease | Ovarian cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.79E-06; Fold-change: -3.59E+00; Z-score: -4.49E+00 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.74E-01; Fold-change: -6.06E-01; Z-score: -6.95E-01 | |
|
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
|
||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
