Molecule Information

General Information of the Molecule (ID: Mol00056)

Name	Protein delta homolog 1 (DLK1) ,Homo sapiens
Synonyms	DLK-1; pG2; FA1; DLK Click to Show/Hide
Molecule Type	Protein
Gene Name	DLK1
Gene ID	8788
Location	chr14:100725705-100738224[+]
Sequence	MTATEALLRVLLLLLAFGHSTYGAECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTS PGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYS GKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCE NDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFT GLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT EGQAICFTILGVLTSLVVLGTVGIVFLNKCETWVSNLRYNHMLRKKKNLLLQYNSGEDLA VNIIFPEKIDMTTFSKEAGDEEI Click to Show/Hide
Function	May have a role in neuroendocrine differentiation. Click to Show/Hide
Uniprot ID	DLK1_HUMAN
Ensembl ID	ENSG00000185559
HGNC ID	HGNC:2907
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Cisplatin

Click to Show/Hide

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Non-small cell lung cancer				[1]
Sensitive Disease	Non-small cell lung cancer [ICD-11: 2C25.Y]			Disease Info
Sensitive Drug	Cisplatin			Drug Info
Molecule Alteration	Expression		Down-regulation
Experimental Note	Revealed Based on the Cell Line Data
In Vitro Model	A549 cells	Lung	Homo sapiens (Human)	CVCL_0023
	H460 cells	Lung	Homo sapiens (Human)	CVCL_0459
Experiment for Molecule Alteration	Western blot analysis; Luciferase reporter assay
Experiment for Drug Resistance	MTT assay; Colony formation assay; DAPI staining assay
Mechanism Description	miR129-5p inhibits non-small cell lung cancer cell stemness and chemoresistance through targeting DLk1.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Click to Show/Hide the Resistance Disease of This Class

Lung cancer [ICD-11: 2C25]

Click to Show/Hide

Differential expression of molecule in resistant diseases
The Studied Tissue	Lung
The Specified Disease	Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.01E-18; Fold-change: 4.07E-02; Z-score: 1.29E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 9.49E-12; Fold-change: 1.33E-01; Z-score: 2.27E-01
Molecule expression in the normal tissue adjacent to the diseased tissue of patients Molecule expression in the diseased tissue of patients Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances		Click to View the Clearer Original Diagram
Download Molecule expression barchart for all samples Download Molecule expression data of patients in the normal section of the tissue adjacent to the disease section Download Molecule expression data of patients in the disease section of the tissue Download Molecule expression data in the tissue of healthy individual

Tissue-specific Molecule Abundances in Healthy Individuals

Click to Show/Hide the Molecule Abundances


Download the Tissue-Specific Variation(s) Profile

References

Ref 1	MiR-129-5p inhibits non-small cell lung cancer cell stemness and chemoresistance through targeting DLK1. Biochem Biophys Res Commun. 2017 Aug 19;490(2):309-316. doi: 10.1016/j.bbrc.2017.06.041. Epub 2017 Jun 12.