Molecule Information

General Information of the Molecule (ID: Mol00056)

• Name: Protein delta homolog 1 (DLK1) ,Homo sapiens
• Synonyms: DLK-1; pG2; FA1; DLK
• Molecule Type: Protein
• Gene Name: DLK1
• Gene ID: 8788
• Location: chr14:100725705-100738224[+]
• Sequence:
  MTATEALLRVLLLLLAFGHSTYGAECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTS
  PGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYS
  GKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCE
  NDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFT
  GLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT
  EGQAICFTILGVLTSLVVLGTVGIVFLNKCETWVSNLRYNHMLRKKKNLLLQYNSGEDLA
  VNIIFPEKIDMTTFSKEAGDEEI
• Function: May have a role in neuroendocrine differentiation.
• Uniprot ID: DLK1_HUMAN
• Ensembl ID: ENSG00000185559
• HGNC ID: HGNC:2907

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Cisplatin

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Non-small cell lung cancer [ICD-11: 2C25.Y] [1]

• Sensitive Disease: Non-small cell lung cancer [ICD-11: 2C25.Y]
• Sensitive Drug: Cisplatin
• Molecule Alteration: Expression; Down-regulation

Differential expression of the molecule in resistant disease

• Classification of Disease: Lung cancer [ICD-11: 2C25]
• The Specified Disease: Non-small cell lung cancer
• The Studied Tissue: Blood
• The Expression Level of Disease Section Compare with the Healthy Individual Tissue: p-value: 8.06E-11; Fold-change: -3.85E-01; Z-score: -6.70E+00
• Experimental Note: Revealed Based on the Cell Line Data
• In Vitro Model: A549 cells; Lung; Homo sapiens (Human); CVCL_0023
• In Vitro Model: H460 cells; Lung; Homo sapiens (Human); CVCL_0459
• Experiment for Molecule Alteration: Western blot analysis; Luciferase reporter assay
• Experiment for Drug Resistance: MTT assay; Colony formation assay; DAPI staining assay
• Mechanism Description: miR129-5p inhibits non-small cell lung cancer cell stemness and chemoresistance through targeting DLk1.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Lung cancer [ICD-11: 2C25]

Differential expression of molecule in resistant diseases

• The Studied Tissue: Lung
• The Specified Disease: Lung cancer
• The Expression Level of Disease Section Compare with the Healthy Individual Tissue: p-value: 2.01E-18; Fold-change: 4.07E-02; Z-score: 1.29E-01
• The Expression Level of Disease Section Compare with the Adjacent Tissue: p-value: 9.49E-12; Fold-change: 1.33E-01; Z-score: 2.27E-01

References

• Ref 1: MiR-129-5p inhibits non-small cell lung cancer cell stemness and chemoresistance through targeting DLK1. Biochem Biophys Res Commun. 2017 Aug 19;490(2):309-316. doi: 10.1016/j.bbrc.2017.06.041. Epub 2017 Jun 12.