Molecule Information
General Information of the Molecule (ID: Mol00053)
| Name |
Catenin beta-1 (CTNNB1)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
Beta-catenin; CTNNB; OK/SW-cl.35; PRO2286
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
CTNNB1
|
||||
| Gene ID | |||||
| Location |
chr3:41194741-41260096[+]
|
||||
| Sequence |
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTS
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD L Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
Key downstream component of the canonical Wnt signaling pathway. In the absence of Wnt, forms a complex with AXIN1, AXIN2, APC, CSNK1A1 and GSK3B that promotes phosphorylation on N-terminal Ser and Thr residues and ubiquitination of CTNNB1 via BTRC and its subsequent degradation by the proteasome. In the presence of Wnt ligand, CTNNB1 is not ubiquitinated and accumulates in the nucleus, where it acts as a coactivator for transcription factors of the TCF/LEF family, leading to activate Wnt responsive genes. Involved in the regulation of cell adhesion, as component of an E-cadherin:catenin adhesion complex. Acts as a negative regulator of centrosome cohesion. Involved in the CDK2/PTPN6/CTNNB1/CEACAM1 pathway of insulin internalization. Blocks anoikis of malignant kidney and intestinal epithelial cells and promotes their anchorage-independent growth by down-regulating DAPK2. Disrupts PML function and PML-NB formation by inhibiting RANBP2-mediated sumoylation of PML. Promotes neurogenesis by maintaining sympathetic neuroblasts within the cell cycle. Involved in chondrocyte differentiation via interaction with SOX9: SOX9-binding competes with the binding sites of TCF/LEF within CTNNB1, thereby inhibiting the Wnt signaling.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Non-small cell lung cancer [ICD-11: 2C25.Y] | [1] | |||
| Resistant Disease | Non-small cell lung cancer [ICD-11: 2C25.Y] | |||
| Resistant Drug | Cisplatin | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Differential expression of the molecule in resistant disease | ||||
| Classification of Disease | Lung cancer [ICD-11: 2C25] | |||
| The Specified Disease | Non-small cell lung cancer | |||
| The Studied Tissue | Lung tissue | |||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 9.15E-01 Fold-change: -3.91E-03 Z-score: -1.07E-01 |
|||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
| In Vitro Model | A549 cells | Lung | Homo sapiens (Human) | CVCL_0023 |
| A549/CDDP cells | Lung | Homo sapiens (Human) | CVCL_0023 | |
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
Flow cytometry assay | |||
| Mechanism Description | Overexpression of beta-catenin not only plays a role in the NSCLC tumorigenesis but also increases chemoresistance. NkD2 inhibits beta-catenin by binding to Dvl protein. knockdown Ak126698 in A549 will decreased expression of NkD2, increased expression of whole beta-catenin and nuclear translocation of beta-catenin. | |||
| Disease Class: Lung cancer [ICD-11: 2C25.5] | [2] | |||
| Resistant Disease | Lung cancer [ICD-11: 2C25.5] | |||
| Resistant Drug | Cisplatin | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Differential expression of the molecule in resistant disease | ||||
| Classification of Disease | Lung cancer [ICD-11: 2C25] | |||
| The Specified Disease | Lung cancer | |||
| The Studied Tissue | Lung tissue | |||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 9.15E-01 Fold-change: -3.91E-03 Z-score: -1.07E-01 |
|||
| Experimental Note | Identified from the Human Clinical Data | |||
| Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
| Cell colony | Inhibition | hsa05200 | ||
| Cell proliferation | Inhibition | hsa05200 | ||
| Wnt/Beta-catenin signaling pathway | Inhibition | hsa04310 | ||
| In Vitro Model | A549 cells | Lung | Homo sapiens (Human) | CVCL_0023 |
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
MTT assay; Flow cytometry assay | |||
| Mechanism Description | Down-regulation of Meg3 enhances cisplatin resistance of lung cancer cells through activation of the WNT/beta-catenin signaling pathway.The present study detected that the expression levels of Meg3 were significantly lower in cisplatin-resistant A549/DDP lung cancer cells, compared with those in parental A549 cells. The results of the present study also demonstrated that the Meg3-mediated chemosensitivity enhancement was associated with the induction of cell-cycle arrest and increased apoptosis, through regulation of p53, beta-catenin and survivin, which is a target gene of the WNT/beta-catenin signaling pathway. | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Gastric cancer [ICD-11: 2B72.1] | [3] | |||
| Sensitive Disease | Gastric cancer [ICD-11: 2B72.1] | |||
| Sensitive Drug | Cisplatin | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
| Cell colony | Inhibition | hsa05200 | ||
| Cell invasion | Inhibition | hsa05200 | ||
| Cell viability | Inhibition | hsa05200 | ||
| Wnt/Beta-catenin signaling pathway | Inhibition | hsa04310 | ||
| In Vitro Model | SGC7901 cells | Gastric | Homo sapiens (Human) | CVCL_0520 |
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
CCK8 assay; Transwell assay; Flow cytometry assay | |||
| Mechanism Description | Silencing of ZFAS1 augmented the sensitivity to cis-platinum or paclitaxel in gastric cancer cancer cells and silencing of ZFAS1-induced inhibition of malignancies was reversed by beta-catenin. | |||
|
|
||||
| Disease Class: Colon cancer [ICD-11: 2B90.1] | [4] | |||
| Sensitive Disease | Colon cancer [ICD-11: 2B90.1] | |||
| Sensitive Drug | Cisplatin | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell growth | Inhibition | hsa05200 | |
| Cell metastasis | Inhibition | hsa05205 | ||
| Wnt/Beta-catenin signaling pathway | Inhibition | hsa04310 | ||
| In Vitro Model | HT29 Cells | Colon | Homo sapiens (Human) | CVCL_A8EZ |
| SW480 cells | Colon | Homo sapiens (Human) | CVCL_0546 | |
| HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |
| HCT8 cells | Colon | Homo sapiens (Human) | CVCL_2478 | |
| In Vivo Model | Nude mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
MTT assay | |||
| Mechanism Description | LINC00261 down-regulated beta-catenin in nuclei and promoted beta-catenin degradation, i.ctivated Wnt/beta-catenin pathway and downstream target genes, then inhibited TCF/LEF/beta-catenin complex formation, and finally, repressed colon cancer and reduced the cisplatin resistance of tumor cells. | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Gastric cancer [ICD-11: 2B72.1] | [3] | |||
| Sensitive Disease | Gastric cancer [ICD-11: 2B72.1] | |||
| Sensitive Drug | Paclitaxel | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Wnt/Beta-catenin signaling pathway | Regulation | N.A. | |
| In Vitro Model | SGC7901 cells | Gastric | Homo sapiens (Human) | CVCL_0520 |
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
CCK8 assay; Transwell assay; Flow cytometry assay | |||
| Mechanism Description | Silencing of ZFAS1 augmented the sensitivity to cis-platinum or paclitaxel in gastric cancer cancer cells and silencing of ZFAS1-induced inhibition of malignancies was reversed by beta-catenin. | |||
Clinical Trial Drug(s)
1 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Colon cancer [ICD-11: 2B90.1] | [5] | |||
| Sensitive Disease | Colon cancer [ICD-11: 2B90.1] | |||
| Sensitive Drug | BAY1161909 | |||
| Molecule Alteration | IF-deletion | p.S45delS (c.133_135delTCT) |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 |
| SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | |
| TOV-21G cells | Ovary | Homo sapiens (Human) | CVCL_3613 | |
| HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | |
| TOV-112D cells | Ovary | Homo sapiens (Human) | CVCL_3612 | |
| LS 174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | |
| A427 cells | Lung | Homo sapiens (Human) | CVCL_1055 | |
| In Vivo Model | Mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Gene set analysis | |||
| Experiment for Drug Resistance |
Cell proliferation assay | |||
| Mechanism Description | The if-deletion p.S45delS (c.133_135delTCT) in gene CTNNB1 cause the sensitivity of BAY1161909 by unusual activation of pro-survival pathway. | |||
| Disease Class: Colorectal cancer [ICD-11: 2B91.1] | [5] | |||
| Sensitive Disease | Colorectal cancer [ICD-11: 2B91.1] | |||
| Sensitive Drug | BAY1161909 | |||
| Molecule Alteration | IF-deletion | p.S45delS (c.133_135delTCT) |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 |
| SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | |
| TOV-21G cells | Ovary | Homo sapiens (Human) | CVCL_3613 | |
| HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | |
| TOV-112D cells | Ovary | Homo sapiens (Human) | CVCL_3612 | |
| LS 174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | |
| A427 cells | Lung | Homo sapiens (Human) | CVCL_1055 | |
| In Vivo Model | Mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Gene set analysis | |||
| Experiment for Drug Resistance |
Cell proliferation assay | |||
| Mechanism Description | The if-deletion p.S45delS (c.133_135delTCT) in gene CTNNB1 cause the sensitivity of BAY1161909 by unusual activation of pro-survival pathway. | |||
| Disease Class: Colorectal cancer [ICD-11: 2B91.1] | [5] | |||
| Sensitive Disease | Colorectal cancer [ICD-11: 2B91.1] | |||
| Sensitive Drug | BAY1161909 | |||
| Molecule Alteration | Missense mutation | p.S33Y (c.98C>A) |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 |
| SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | |
| TOV-21G cells | Ovary | Homo sapiens (Human) | CVCL_3613 | |
| HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | |
| TOV-112D cells | Ovary | Homo sapiens (Human) | CVCL_3612 | |
| LS 174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | |
| A427 cells | Lung | Homo sapiens (Human) | CVCL_1055 | |
| In Vivo Model | Mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Gene set analysis | |||
| Experiment for Drug Resistance |
Cell proliferation assay | |||
| Mechanism Description | The missense mutation p.S33Y (c.98C>A) in gene CTNNB1 cause the sensitivity of BAY1161909 by unusual activation of pro-survival pathway | |||
| Disease Class: Lung adenocarcinoma [ICD-11: 2C25.0] | [5] | |||
| Sensitive Disease | Lung adenocarcinoma [ICD-11: 2C25.0] | |||
| Sensitive Drug | BAY1161909 | |||
| Molecule Alteration | Missense mutation | p.T41A (c.121A>G) |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 |
| SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | |
| TOV-21G cells | Ovary | Homo sapiens (Human) | CVCL_3613 | |
| HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | |
| TOV-112D cells | Ovary | Homo sapiens (Human) | CVCL_3612 | |
| LS 174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | |
| A427 cells | Lung | Homo sapiens (Human) | CVCL_1055 | |
| In Vivo Model | Mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Gene set analysis | |||
| Experiment for Drug Resistance |
Cell proliferation assay | |||
| Mechanism Description | The missense mutation p.T41A (c.121A>G) in gene CTNNB1 cause the sensitivity of BAY1161909 by unusual activation of pro-survival pathway | |||
Preclinical Drug(s)
6 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | |||||||||||||
|
|
|||||||||||||
| Disease Class: Colorectal cancer [ICD-11: 2B91.1] | [5] | ||||||||||||
| Sensitive Disease | Colorectal cancer [ICD-11: 2B91.1] | ||||||||||||
| Sensitive Drug | BAY1217389 | ||||||||||||
| Molecule Alteration | Missense mutation | p.S45F (c.134C>T) |
|||||||||||
| Wild Type Structure | Method: X-ray diffraction | Resolution: 2.20 Å | |||||||||||
| Mutant Type Structure | Method: X-ray diffraction | Resolution: 2.45 Å | |||||||||||
| Download The Information of Sequence | Download The Structure File | ||||||||||||
-
T
T
T
T
A
A
P
P
S
F
L
L
S
S
G
G
K
K
|
|||||||||||||
| Experimental Note | Revealed Based on the Cell Line Data | ||||||||||||
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |||||||||
| SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | ||||||||||
| TOV-21G cells | Ovary | Homo sapiens (Human) | CVCL_3613 | ||||||||||
| HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | ||||||||||
| TOV-112D cells | Ovary | Homo sapiens (Human) | CVCL_3612 | ||||||||||
| LS 174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | ||||||||||
| A427 cells | Lung | Homo sapiens (Human) | CVCL_1055 | ||||||||||
| In Vivo Model | Mouse xenograft model | Mus musculus | |||||||||||
| Experiment for Molecule Alteration |
Gene set analysis | ||||||||||||
| Experiment for Drug Resistance |
Cell proliferation assay | ||||||||||||
| Mechanism Description | The missense mutation p.S45F (c.134C>T) in gene CTNNB1 cause the sensitivity of BAY1217389 by unusual activation of pro-survival pathway | ||||||||||||
| Disease Class: Colon cancer [ICD-11: 2B90.1] | [5] | ||||||||||||
| Sensitive Disease | Colon cancer [ICD-11: 2B90.1] | ||||||||||||
| Sensitive Drug | BAY1217389 | ||||||||||||
| Molecule Alteration | IF-deletion | p.S45delS (c.133_135delTCT) |
|||||||||||
| Experimental Note | Revealed Based on the Cell Line Data | ||||||||||||
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |||||||||
| SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | ||||||||||
| TOV-21G cells | Ovary | Homo sapiens (Human) | CVCL_3613 | ||||||||||
| HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | ||||||||||
| TOV-112D cells | Ovary | Homo sapiens (Human) | CVCL_3612 | ||||||||||
| LS 174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | ||||||||||
| A427 cells | Lung | Homo sapiens (Human) | CVCL_1055 | ||||||||||
| In Vivo Model | Mouse xenograft model | Mus musculus | |||||||||||
| Experiment for Molecule Alteration |
Gene set analysis | ||||||||||||
| Experiment for Drug Resistance |
Cell proliferation assay | ||||||||||||
| Mechanism Description | The if-deletion p.S45delS (c.133_135delTCT) in gene CTNNB1 cause the sensitivity of BAY1217389 by unusual activation of pro-survival pathway. | ||||||||||||
| Disease Class: Colorectal cancer [ICD-11: 2B91.1] | [5] | ||||||||||||
| Sensitive Disease | Colorectal cancer [ICD-11: 2B91.1] | ||||||||||||
| Sensitive Drug | BAY1217389 | ||||||||||||
| Molecule Alteration | Missense mutation | p.S33Y (c.98C>A) |
|||||||||||
| Experimental Note | Revealed Based on the Cell Line Data | ||||||||||||
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |||||||||
| SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | ||||||||||
| TOV-21G cells | Ovary | Homo sapiens (Human) | CVCL_3613 | ||||||||||
| HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | ||||||||||
| TOV-112D cells | Ovary | Homo sapiens (Human) | CVCL_3612 | ||||||||||
| LS 174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | ||||||||||
| A427 cells | Lung | Homo sapiens (Human) | CVCL_1055 | ||||||||||
| In Vivo Model | Mouse xenograft model | Mus musculus | |||||||||||
| Experiment for Molecule Alteration |
Gene set analysis | ||||||||||||
| Experiment for Drug Resistance |
Cell proliferation assay | ||||||||||||
| Mechanism Description | The missense mutation p.S33Y (c.98C>A) in gene CTNNB1 cause the sensitivity of BAY1217389 by unusual activation of pro-survival pathway | ||||||||||||
| Disease Class: Lung adenocarcinoma [ICD-11: 2C25.0] | [5] | ||||||||||||
| Sensitive Disease | Lung adenocarcinoma [ICD-11: 2C25.0] | ||||||||||||
| Sensitive Drug | BAY1217389 | ||||||||||||
| Molecule Alteration | Missense mutation | p.T41A (c.121A>G) |
|||||||||||
| Experimental Note | Revealed Based on the Cell Line Data | ||||||||||||
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |||||||||
| SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | ||||||||||
| TOV-21G cells | Ovary | Homo sapiens (Human) | CVCL_3613 | ||||||||||
| HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | ||||||||||
| TOV-112D cells | Ovary | Homo sapiens (Human) | CVCL_3612 | ||||||||||
| LS 174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | ||||||||||
| A427 cells | Lung | Homo sapiens (Human) | CVCL_1055 | ||||||||||
| In Vivo Model | Mouse xenograft model | Mus musculus | |||||||||||
| Experiment for Molecule Alteration |
Gene set analysis | ||||||||||||
| Experiment for Drug Resistance |
Cell proliferation assay | ||||||||||||
| Mechanism Description | The missense mutation p.T41A (c.121A>G) in gene CTNNB1 cause the sensitivity of BAY1217389 by unusual activation of pro-survival pathway | ||||||||||||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Colorectal cancer [ICD-11: 2B91.1] | [6] | |||
| Resistant Disease | Colorectal cancer [ICD-11: 2B91.1] | |||
| Resistant Drug | G007-LK | |||
| Molecule Alteration | Missense mutation | p.S33F (c.98C>T) |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | DLD1 cells | Colon | Homo sapiens (Human) | CVCL_0248 |
| HEK293T cells | Kidney | Homo sapiens (Human) | CVCL_0063 | |
| NIH 3T3 cells | Colon | Homo sapiens (Human) | CVCL_0594 | |
| In Vivo Model | ApcMin mouse model; Lgr5-GFP-IRES-CreER mouse model; CAGs-rtTA mouse model; Col1A1 mouse model; TG-shApc.2235E mouse model; TG-Ren.713 mouse model; TG-shTnks1/2-3341-1328 mouse model; TG-shTnks1/2-1385-3004 mouse model; Apc Q1405X mouse model | Mus musculus | ||
| Experiment for Molecule Alteration |
qPCR | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | |||||||||||||
|
|
|||||||||||||
| Disease Class: Colorectal cancer [ICD-11: 2B91.1] | [5] | ||||||||||||
| Sensitive Disease | Colorectal cancer [ICD-11: 2B91.1] | ||||||||||||
| Sensitive Drug | MPI-0479605 | ||||||||||||
| Molecule Alteration | Missense mutation | p.S45F (c.134C>T) |
|||||||||||
| Wild Type Structure | Method: X-ray diffraction | Resolution: 2.20 Å | |||||||||||
| Mutant Type Structure | Method: X-ray diffraction | Resolution: 2.45 Å | |||||||||||
| Download The Information of Sequence | Download The Structure File | ||||||||||||
-
T
T
T
T
A
A
P
P
S
F
L
L
S
S
G
G
K
K
|
|||||||||||||
| Experimental Note | Revealed Based on the Cell Line Data | ||||||||||||
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |||||||||
| SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | ||||||||||
| TOV-21G cells | Ovary | Homo sapiens (Human) | CVCL_3613 | ||||||||||
| HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | ||||||||||
| TOV-112D cells | Ovary | Homo sapiens (Human) | CVCL_3612 | ||||||||||
| LS 174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | ||||||||||
| A427 cells | Lung | Homo sapiens (Human) | CVCL_1055 | ||||||||||
| In Vivo Model | Mouse xenograft model | Mus musculus | |||||||||||
| Experiment for Molecule Alteration |
Gene set analysis | ||||||||||||
| Experiment for Drug Resistance |
Cell proliferation assay | ||||||||||||
| Mechanism Description | The missense mutation p.S45F (c.134C>T) in gene CTNNB1 cause the sensitivity of MPI-0479605 by unusual activation of pro-survival pathway | ||||||||||||
| Disease Class: Colon cancer [ICD-11: 2B90.1] | [5] | ||||||||||||
| Sensitive Disease | Colon cancer [ICD-11: 2B90.1] | ||||||||||||
| Sensitive Drug | MPI-0479605 | ||||||||||||
| Molecule Alteration | IF-deletion | p.S45delS (c.133_135delTCT) |
|||||||||||
| Experimental Note | Revealed Based on the Cell Line Data | ||||||||||||
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |||||||||
| SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | ||||||||||
| TOV-21G cells | Ovary | Homo sapiens (Human) | CVCL_3613 | ||||||||||
| HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | ||||||||||
| TOV-112D cells | Ovary | Homo sapiens (Human) | CVCL_3612 | ||||||||||
| LS 174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | ||||||||||
| A427 cells | Lung | Homo sapiens (Human) | CVCL_1055 | ||||||||||
| In Vivo Model | Mouse xenograft model | Mus musculus | |||||||||||
| Experiment for Molecule Alteration |
Gene set analysis | ||||||||||||
| Experiment for Drug Resistance |
Cell proliferation assay | ||||||||||||
| Mechanism Description | The if-deletion p.S45delS (c.133_135delTCT) in gene CTNNB1 cause the sensitivity of MPI-0479605 by unusual activation of pro-survival pathway. | ||||||||||||
| Disease Class: Colorectal cancer [ICD-11: 2B91.1] | [5] | ||||||||||||
| Sensitive Disease | Colorectal cancer [ICD-11: 2B91.1] | ||||||||||||
| Sensitive Drug | MPI-0479605 | ||||||||||||
| Molecule Alteration | Missense mutation | p.S33Y (c.98C>A) |
|||||||||||
| Experimental Note | Revealed Based on the Cell Line Data | ||||||||||||
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |||||||||
| SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | ||||||||||
| TOV-21G cells | Ovary | Homo sapiens (Human) | CVCL_3613 | ||||||||||
| HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | ||||||||||
| TOV-112D cells | Ovary | Homo sapiens (Human) | CVCL_3612 | ||||||||||
| LS 174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | ||||||||||
| A427 cells | Lung | Homo sapiens (Human) | CVCL_1055 | ||||||||||
| In Vivo Model | Mouse xenograft model | Mus musculus | |||||||||||
| Experiment for Molecule Alteration |
Gene set analysis | ||||||||||||
| Experiment for Drug Resistance |
Cell proliferation assay | ||||||||||||
| Mechanism Description | The missense mutation p.S33Y (c.98C>A) in gene CTNNB1 cause the sensitivity of MPI-0479605 by unusual activation of pro-survival pathway | ||||||||||||
| Disease Class: Lung adenocarcinoma [ICD-11: 2C25.0] | [5] | ||||||||||||
| Sensitive Disease | Lung adenocarcinoma [ICD-11: 2C25.0] | ||||||||||||
| Sensitive Drug | MPI-0479605 | ||||||||||||
| Molecule Alteration | Missense mutation | p.T41A (c.121A>G) |
|||||||||||
| Experimental Note | Revealed Based on the Cell Line Data | ||||||||||||
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |||||||||
| SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | ||||||||||
| TOV-21G cells | Ovary | Homo sapiens (Human) | CVCL_3613 | ||||||||||
| HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | ||||||||||
| TOV-112D cells | Ovary | Homo sapiens (Human) | CVCL_3612 | ||||||||||
| LS 174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | ||||||||||
| A427 cells | Lung | Homo sapiens (Human) | CVCL_1055 | ||||||||||
| In Vivo Model | Mouse xenograft model | Mus musculus | |||||||||||
| Experiment for Molecule Alteration |
Gene set analysis | ||||||||||||
| Experiment for Drug Resistance |
Cell proliferation assay | ||||||||||||
| Mechanism Description | The missense mutation p.T41A (c.121A>G) in gene CTNNB1 cause the sensitivity of MPI-0479605 by unusual activation of pro-survival pathway | ||||||||||||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | |||||||||||||
|
|
|||||||||||||
| Disease Class: Colorectal cancer [ICD-11: 2B91.1] | [5] | ||||||||||||
| Sensitive Disease | Colorectal cancer [ICD-11: 2B91.1] | ||||||||||||
| Sensitive Drug | Mps-BAY2b | ||||||||||||
| Molecule Alteration | Missense mutation | p.S45F (c.134C>T) |
|||||||||||
| Wild Type Structure | Method: X-ray diffraction | Resolution: 2.20 Å | |||||||||||
| Mutant Type Structure | Method: X-ray diffraction | Resolution: 2.45 Å | |||||||||||
| Download The Information of Sequence | Download The Structure File | ||||||||||||
-
T
T
T
T
A
A
P
P
S
F
L
L
S
S
G
G
K
K
|
|||||||||||||
| Experimental Note | Revealed Based on the Cell Line Data | ||||||||||||
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |||||||||
| SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | ||||||||||
| TOV-21G cells | Ovary | Homo sapiens (Human) | CVCL_3613 | ||||||||||
| HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | ||||||||||
| TOV-112D cells | Ovary | Homo sapiens (Human) | CVCL_3612 | ||||||||||
| LS 174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | ||||||||||
| A427 cells | Lung | Homo sapiens (Human) | CVCL_1055 | ||||||||||
| In Vivo Model | Mouse xenograft model | Mus musculus | |||||||||||
| Experiment for Molecule Alteration |
Gene set analysis | ||||||||||||
| Experiment for Drug Resistance |
Cell proliferation assay | ||||||||||||
| Mechanism Description | The missense mutation p.S45F (c.134C>T) in gene CTNNB1 cause the sensitivity of Mps-BAY2b by unusual activation of pro-survival pathway | ||||||||||||
| Disease Class: Colon cancer [ICD-11: 2B90.1] | [5] | ||||||||||||
| Sensitive Disease | Colon cancer [ICD-11: 2B90.1] | ||||||||||||
| Sensitive Drug | Mps-BAY2b | ||||||||||||
| Molecule Alteration | IF-deletion | p.S45delS (c.133_135delTCT) |
|||||||||||
| Experimental Note | Revealed Based on the Cell Line Data | ||||||||||||
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |||||||||
| SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | ||||||||||
| TOV-21G cells | Ovary | Homo sapiens (Human) | CVCL_3613 | ||||||||||
| HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | ||||||||||
| TOV-112D cells | Ovary | Homo sapiens (Human) | CVCL_3612 | ||||||||||
| LS 174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | ||||||||||
| A427 cells | Lung | Homo sapiens (Human) | CVCL_1055 | ||||||||||
| In Vivo Model | Mouse xenograft model | Mus musculus | |||||||||||
| Experiment for Molecule Alteration |
Gene set analysis | ||||||||||||
| Experiment for Drug Resistance |
Cell proliferation assay | ||||||||||||
| Mechanism Description | The if-deletion p.S45delS (c.133_135delTCT) in gene CTNNB1 cause the sensitivity of Mps-BAY2b by unusual activation of pro-survival pathway. | ||||||||||||
| Disease Class: Colorectal cancer [ICD-11: 2B91.1] | [5] | ||||||||||||
| Sensitive Disease | Colorectal cancer [ICD-11: 2B91.1] | ||||||||||||
| Sensitive Drug | Mps-BAY2b | ||||||||||||
| Molecule Alteration | Missense mutation | p.S33Y (c.98C>A) |
|||||||||||
| Experimental Note | Revealed Based on the Cell Line Data | ||||||||||||
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |||||||||
| SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | ||||||||||
| TOV-21G cells | Ovary | Homo sapiens (Human) | CVCL_3613 | ||||||||||
| HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | ||||||||||
| TOV-112D cells | Ovary | Homo sapiens (Human) | CVCL_3612 | ||||||||||
| LS 174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | ||||||||||
| A427 cells | Lung | Homo sapiens (Human) | CVCL_1055 | ||||||||||
| In Vivo Model | Mouse xenograft model | Mus musculus | |||||||||||
| Experiment for Molecule Alteration |
Gene set analysis | ||||||||||||
| Experiment for Drug Resistance |
Cell proliferation assay | ||||||||||||
| Mechanism Description | The missense mutation p.S33Y (c.98C>A) in gene CTNNB1 cause the sensitivity of Mps-BAY2b by unusual activation of pro-survival pathway | ||||||||||||
| Disease Class: Lung adenocarcinoma [ICD-11: 2C25.0] | [5] | ||||||||||||
| Sensitive Disease | Lung adenocarcinoma [ICD-11: 2C25.0] | ||||||||||||
| Sensitive Drug | Mps-BAY2b | ||||||||||||
| Molecule Alteration | Missense mutation | p.T41A (c.121A>G) |
|||||||||||
| Experimental Note | Revealed Based on the Cell Line Data | ||||||||||||
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |||||||||
| SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | ||||||||||
| TOV-21G cells | Ovary | Homo sapiens (Human) | CVCL_3613 | ||||||||||
| HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | ||||||||||
| TOV-112D cells | Ovary | Homo sapiens (Human) | CVCL_3612 | ||||||||||
| LS 174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | ||||||||||
| A427 cells | Lung | Homo sapiens (Human) | CVCL_1055 | ||||||||||
| In Vivo Model | Mouse xenograft model | Mus musculus | |||||||||||
| Experiment for Molecule Alteration |
Gene set analysis | ||||||||||||
| Experiment for Drug Resistance |
Cell proliferation assay | ||||||||||||
| Mechanism Description | The missense mutation p.T41A (c.121A>G) in gene CTNNB1 cause the sensitivity of Mps-BAY2b by unusual activation of pro-survival pathway | ||||||||||||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | |||||||||||||
|
|
|||||||||||||
| Disease Class: Colorectal cancer [ICD-11: 2B91.1] | [5] | ||||||||||||
| Sensitive Disease | Colorectal cancer [ICD-11: 2B91.1] | ||||||||||||
| Sensitive Drug | Mps1-IN-1 | ||||||||||||
| Molecule Alteration | Missense mutation | p.S45F (c.134C>T) |
|||||||||||
| Wild Type Structure | Method: X-ray diffraction | Resolution: 2.20 Å | |||||||||||
| Mutant Type Structure | Method: X-ray diffraction | Resolution: 2.45 Å | |||||||||||
| Download The Information of Sequence | Download The Structure File | ||||||||||||
-
T
T
T
T
A
A
P
P
S
F
L
L
S
S
G
G
K
K
|
|||||||||||||
| Experimental Note | Revealed Based on the Cell Line Data | ||||||||||||
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |||||||||
| SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | ||||||||||
| TOV-21G cells | Ovary | Homo sapiens (Human) | CVCL_3613 | ||||||||||
| HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | ||||||||||
| TOV-112D cells | Ovary | Homo sapiens (Human) | CVCL_3612 | ||||||||||
| LS 174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | ||||||||||
| A427 cells | Lung | Homo sapiens (Human) | CVCL_1055 | ||||||||||
| In Vivo Model | Mouse xenograft model | Mus musculus | |||||||||||
| Experiment for Molecule Alteration |
Gene set analysis | ||||||||||||
| Experiment for Drug Resistance |
Cell proliferation assay | ||||||||||||
| Mechanism Description | The missense mutation p.S45F (c.134C>T) in gene CTNNB1 cause the sensitivity of Mps1-IN-1 by unusual activation of pro-survival pathway | ||||||||||||
| Disease Class: Colon cancer [ICD-11: 2B90.1] | [5] | ||||||||||||
| Sensitive Disease | Colon cancer [ICD-11: 2B90.1] | ||||||||||||
| Sensitive Drug | Mps1-IN-1 | ||||||||||||
| Molecule Alteration | IF-deletion | p.S45delS (c.133_135delTCT) |
|||||||||||
| Experimental Note | Revealed Based on the Cell Line Data | ||||||||||||
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |||||||||
| SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | ||||||||||
| TOV-21G cells | Ovary | Homo sapiens (Human) | CVCL_3613 | ||||||||||
| HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | ||||||||||
| TOV-112D cells | Ovary | Homo sapiens (Human) | CVCL_3612 | ||||||||||
| LS 174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | ||||||||||
| A427 cells | Lung | Homo sapiens (Human) | CVCL_1055 | ||||||||||
| In Vivo Model | Mouse xenograft model | Mus musculus | |||||||||||
| Experiment for Molecule Alteration |
Gene set analysis | ||||||||||||
| Experiment for Drug Resistance |
Cell proliferation assay | ||||||||||||
| Mechanism Description | The if-deletion p.S45delS (c.133_135delTCT) in gene CTNNB1 cause the sensitivity of Mps1-IN-1 by unusual activation of pro-survival pathway. | ||||||||||||
| Disease Class: Colorectal cancer [ICD-11: 2B91.1] | [5] | ||||||||||||
| Sensitive Disease | Colorectal cancer [ICD-11: 2B91.1] | ||||||||||||
| Sensitive Drug | Mps1-IN-1 | ||||||||||||
| Molecule Alteration | Missense mutation | p.S33Y (c.98C>A) |
|||||||||||
| Experimental Note | Revealed Based on the Cell Line Data | ||||||||||||
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |||||||||
| SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | ||||||||||
| TOV-21G cells | Ovary | Homo sapiens (Human) | CVCL_3613 | ||||||||||
| HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | ||||||||||
| TOV-112D cells | Ovary | Homo sapiens (Human) | CVCL_3612 | ||||||||||
| LS 174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | ||||||||||
| A427 cells | Lung | Homo sapiens (Human) | CVCL_1055 | ||||||||||
| In Vivo Model | Mouse xenograft model | Mus musculus | |||||||||||
| Experiment for Molecule Alteration |
Gene set analysis | ||||||||||||
| Experiment for Drug Resistance |
Cell proliferation assay | ||||||||||||
| Mechanism Description | The missense mutation p.S33Y (c.98C>A) in gene CTNNB1 cause the sensitivity of Mps1-IN-1 by unusual activation of pro-survival pathway | ||||||||||||
| Disease Class: Lung adenocarcinoma [ICD-11: 2C25.0] | [5] | ||||||||||||
| Sensitive Disease | Lung adenocarcinoma [ICD-11: 2C25.0] | ||||||||||||
| Sensitive Drug | Mps1-IN-1 | ||||||||||||
| Molecule Alteration | Missense mutation | p.T41A (c.121A>G) |
|||||||||||
| Experimental Note | Revealed Based on the Cell Line Data | ||||||||||||
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |||||||||
| SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | ||||||||||
| TOV-21G cells | Ovary | Homo sapiens (Human) | CVCL_3613 | ||||||||||
| HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | ||||||||||
| TOV-112D cells | Ovary | Homo sapiens (Human) | CVCL_3612 | ||||||||||
| LS 174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | ||||||||||
| A427 cells | Lung | Homo sapiens (Human) | CVCL_1055 | ||||||||||
| In Vivo Model | Mouse xenograft model | Mus musculus | |||||||||||
| Experiment for Molecule Alteration |
Gene set analysis | ||||||||||||
| Experiment for Drug Resistance |
Cell proliferation assay | ||||||||||||
| Mechanism Description | The missense mutation p.T41A (c.121A>G) in gene CTNNB1 cause the sensitivity of Mps1-IN-1 by unusual activation of pro-survival pathway | ||||||||||||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | |||||||||||||
|
|
|||||||||||||
| Disease Class: Colorectal cancer [ICD-11: 2B91.1] | [5] | ||||||||||||
| Sensitive Disease | Colorectal cancer [ICD-11: 2B91.1] | ||||||||||||
| Sensitive Drug | NTRC 0066-0 | ||||||||||||
| Molecule Alteration | Missense mutation | p.S45F (c.134C>T) |
|||||||||||
| Wild Type Structure | Method: X-ray diffraction | Resolution: 2.20 Å | |||||||||||
| Mutant Type Structure | Method: X-ray diffraction | Resolution: 2.45 Å | |||||||||||
| Download The Information of Sequence | Download The Structure File | ||||||||||||
-
T
T
T
T
A
A
P
P
S
F
L
L
S
S
G
G
K
K
|
|||||||||||||
| Experimental Note | Revealed Based on the Cell Line Data | ||||||||||||
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |||||||||
| SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | ||||||||||
| TOV-21G cells | Ovary | Homo sapiens (Human) | CVCL_3613 | ||||||||||
| HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | ||||||||||
| TOV-112D cells | Ovary | Homo sapiens (Human) | CVCL_3612 | ||||||||||
| LS 174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | ||||||||||
| A427 cells | Lung | Homo sapiens (Human) | CVCL_1055 | ||||||||||
| In Vivo Model | Mouse xenograft model | Mus musculus | |||||||||||
| Experiment for Molecule Alteration |
Gene set analysis | ||||||||||||
| Experiment for Drug Resistance |
Cell proliferation assay | ||||||||||||
| Mechanism Description | The missense mutation p.S45F (c.134C>T) in gene CTNNB1 cause the sensitivity of NTRC 0066-0 by unusual activation of pro-survival pathway | ||||||||||||
| Disease Class: Lung adenocarcinoma [ICD-11: 2C25.0] | [5] | ||||||||||||
| Sensitive Disease | Lung adenocarcinoma [ICD-11: 2C25.0] | ||||||||||||
| Sensitive Drug | NTRC 0066-0 | ||||||||||||
| Molecule Alteration | Missense mutation | p.T41A (c.121A>G) |
|||||||||||
| Experimental Note | Revealed Based on the Cell Line Data | ||||||||||||
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |||||||||
| SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | ||||||||||
| TOV-21G cells | Ovary | Homo sapiens (Human) | CVCL_3613 | ||||||||||
| HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | ||||||||||
| TOV-112D cells | Ovary | Homo sapiens (Human) | CVCL_3612 | ||||||||||
| LS 174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | ||||||||||
| A427 cells | Lung | Homo sapiens (Human) | CVCL_1055 | ||||||||||
| In Vivo Model | Mouse xenograft model | Mus musculus | |||||||||||
| Experiment for Molecule Alteration |
Gene set analysis | ||||||||||||
| Experiment for Drug Resistance |
Cell proliferation assay | ||||||||||||
| Mechanism Description | The missense mutation p.T41A (c.121A>G) in gene CTNNB1 cause the sensitivity of NTRC 0066-0 by unusual activation of pro-survival pathway | ||||||||||||
| Disease Class: Colon cancer [ICD-11: 2B90.1] | [5] | ||||||||||||
| Sensitive Disease | Colon cancer [ICD-11: 2B90.1] | ||||||||||||
| Sensitive Drug | NTRC 0066-0 | ||||||||||||
| Molecule Alteration | IF-deletion | p.S45delS (c.133_135delTCT) |
|||||||||||
| Experimental Note | Revealed Based on the Cell Line Data | ||||||||||||
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |||||||||
| SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | ||||||||||
| TOV-21G cells | Ovary | Homo sapiens (Human) | CVCL_3613 | ||||||||||
| HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | ||||||||||
| TOV-112D cells | Ovary | Homo sapiens (Human) | CVCL_3612 | ||||||||||
| LS 174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | ||||||||||
| A427 cells | Lung | Homo sapiens (Human) | CVCL_1055 | ||||||||||
| In Vivo Model | Mouse xenograft model | Mus musculus | |||||||||||
| Experiment for Molecule Alteration |
Gene set analysis | ||||||||||||
| Experiment for Drug Resistance |
Cell proliferation assay | ||||||||||||
| Mechanism Description | The if-deletion p.S45delS (c.133_135delTCT) in gene CTNNB1 cause the sensitivity of NTRC 0066-0 by unusual activation of pro-survival pathway. | ||||||||||||
| Disease Class: Colorectal cancer [ICD-11: 2B91.1] | [5] | ||||||||||||
| Sensitive Disease | Colorectal cancer [ICD-11: 2B91.1] | ||||||||||||
| Sensitive Drug | NTRC 0066-0 | ||||||||||||
| Molecule Alteration | Missense mutation | p.S33Y (c.98C>A) |
|||||||||||
| Experimental Note | Revealed Based on the Cell Line Data | ||||||||||||
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |||||||||
| SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | ||||||||||
| TOV-21G cells | Ovary | Homo sapiens (Human) | CVCL_3613 | ||||||||||
| HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | ||||||||||
| TOV-112D cells | Ovary | Homo sapiens (Human) | CVCL_3612 | ||||||||||
| LS 174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | ||||||||||
| A427 cells | Lung | Homo sapiens (Human) | CVCL_1055 | ||||||||||
| In Vivo Model | Mouse xenograft model | Mus musculus | |||||||||||
| Experiment for Molecule Alteration |
Gene set analysis | ||||||||||||
| Experiment for Drug Resistance |
Cell proliferation assay | ||||||||||||
| Mechanism Description | The missense mutation p.S33Y (c.98C>A) in gene CTNNB1 cause the sensitivity of NTRC 0066-0 by unusual activation of pro-survival pathway | ||||||||||||
Investigative Drug(s)
1 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | |||||||||||||
|
|
|||||||||||||
| Disease Class: Colorectal cancer [ICD-11: 2B91.1] | [5] | ||||||||||||
| Sensitive Disease | Colorectal cancer [ICD-11: 2B91.1] | ||||||||||||
| Sensitive Drug | NMS-P715 | ||||||||||||
| Molecule Alteration | Missense mutation | p.S45F (c.134C>T) |
|||||||||||
| Wild Type Structure | Method: X-ray diffraction | Resolution: 2.20 Å | |||||||||||
| Mutant Type Structure | Method: X-ray diffraction | Resolution: 2.45 Å | |||||||||||
| Download The Information of Sequence | Download The Structure File | ||||||||||||
-
T
T
T
T
A
A
P
P
S
F
L
L
S
S
G
G
K
K
|
|||||||||||||
| Experimental Note | Revealed Based on the Cell Line Data | ||||||||||||
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |||||||||
| SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | ||||||||||
| TOV-21G cells | Ovary | Homo sapiens (Human) | CVCL_3613 | ||||||||||
| HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | ||||||||||
| TOV-112D cells | Ovary | Homo sapiens (Human) | CVCL_3612 | ||||||||||
| LS 174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | ||||||||||
| A427 cells | Lung | Homo sapiens (Human) | CVCL_1055 | ||||||||||
| In Vivo Model | Mouse xenograft model | Mus musculus | |||||||||||
| Experiment for Molecule Alteration |
Gene set analysis | ||||||||||||
| Experiment for Drug Resistance |
Cell proliferation assay | ||||||||||||
| Mechanism Description | The missense mutation p.S45F (c.134C>T) in gene CTNNB1 cause the sensitivity of NMS-P715 by unusual activation of pro-survival pathway | ||||||||||||
| Disease Class: Colon cancer [ICD-11: 2B90.1] | [5] | ||||||||||||
| Sensitive Disease | Colon cancer [ICD-11: 2B90.1] | ||||||||||||
| Sensitive Drug | NMS-P715 | ||||||||||||
| Molecule Alteration | IF-deletion | p.S45delS (c.133_135delTCT) |
|||||||||||
| Experimental Note | Revealed Based on the Cell Line Data | ||||||||||||
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |||||||||
| SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | ||||||||||
| TOV-21G cells | Ovary | Homo sapiens (Human) | CVCL_3613 | ||||||||||
| HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | ||||||||||
| TOV-112D cells | Ovary | Homo sapiens (Human) | CVCL_3612 | ||||||||||
| LS 174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | ||||||||||
| A427 cells | Lung | Homo sapiens (Human) | CVCL_1055 | ||||||||||
| In Vivo Model | Mouse xenograft model | Mus musculus | |||||||||||
| Experiment for Molecule Alteration |
Gene set analysis | ||||||||||||
| Experiment for Drug Resistance |
Cell proliferation assay | ||||||||||||
| Mechanism Description | The if-deletion p.S45delS (c.133_135delTCT) in gene CTNNB1 cause the sensitivity of NMS-P715 by unusual activation of pro-survival pathway. | ||||||||||||
| Disease Class: Colorectal cancer [ICD-11: 2B91.1] | [5] | ||||||||||||
| Sensitive Disease | Colorectal cancer [ICD-11: 2B91.1] | ||||||||||||
| Sensitive Drug | NMS-P715 | ||||||||||||
| Molecule Alteration | Missense mutation | p.S33Y (c.98C>A) |
|||||||||||
| Experimental Note | Revealed Based on the Cell Line Data | ||||||||||||
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |||||||||
| SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | ||||||||||
| TOV-21G cells | Ovary | Homo sapiens (Human) | CVCL_3613 | ||||||||||
| HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | ||||||||||
| TOV-112D cells | Ovary | Homo sapiens (Human) | CVCL_3612 | ||||||||||
| LS 174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | ||||||||||
| A427 cells | Lung | Homo sapiens (Human) | CVCL_1055 | ||||||||||
| In Vivo Model | Mouse xenograft model | Mus musculus | |||||||||||
| Experiment for Molecule Alteration |
Gene set analysis | ||||||||||||
| Experiment for Drug Resistance |
Cell proliferation assay | ||||||||||||
| Mechanism Description | The missense mutation p.S33Y (c.98C>A) in gene CTNNB1 cause the sensitivity of NMS-P715 by unusual activation of pro-survival pathway | ||||||||||||
| Disease Class: Lung adenocarcinoma [ICD-11: 2C25.0] | [5] | ||||||||||||
| Sensitive Disease | Lung adenocarcinoma [ICD-11: 2C25.0] | ||||||||||||
| Sensitive Drug | NMS-P715 | ||||||||||||
| Molecule Alteration | Missense mutation | p.T41A (c.121A>G) |
|||||||||||
| Experimental Note | Revealed Based on the Cell Line Data | ||||||||||||
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 | |||||||||
| SW48 cells | Colon | Homo sapiens (Human) | CVCL_1724 | ||||||||||
| TOV-21G cells | Ovary | Homo sapiens (Human) | CVCL_3613 | ||||||||||
| HuTu80 cells | Small intestine | Homo sapiens (Human) | CVCL_1301 | ||||||||||
| TOV-112D cells | Ovary | Homo sapiens (Human) | CVCL_3612 | ||||||||||
| LS 174T cells | Colon | Homo sapiens (Human) | CVCL_1384 | ||||||||||
| A427 cells | Lung | Homo sapiens (Human) | CVCL_1055 | ||||||||||
| In Vivo Model | Mouse xenograft model | Mus musculus | |||||||||||
| Experiment for Molecule Alteration |
Gene set analysis | ||||||||||||
| Experiment for Drug Resistance |
Cell proliferation assay | ||||||||||||
| Mechanism Description | The missense mutation p.T41A (c.121A>G) in gene CTNNB1 cause the sensitivity of NMS-P715 by unusual activation of pro-survival pathway | ||||||||||||
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Gastric tissue | |
| The Specified Disease | Gastric cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 8.44E-02; Fold-change: 1.13E+00; Z-score: 2.49E+00 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 7.21E-01; Fold-change: 5.11E-02; Z-score: 8.51E-02 | |
|
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Colon | |
| The Specified Disease | Colon cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.91E-42; Fold-change: 1.27E+00; Z-score: 1.63E+00 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 5.15E-22; Fold-change: 1.00E+00; Z-score: 1.30E+00 | |
|
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Lung | |
| The Specified Disease | Lung cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.22E-01; Fold-change: 1.04E-01; Z-score: 9.90E-02 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 9.56E-01; Fold-change: -1.07E-02; Z-score: -1.57E-02 | |
|
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
|
||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
