Molecule Information
General Information of the Molecule (ID: Mol00001)
Name |
PP2A B subunit isoform R5-alpha (PPP2R5A)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
PP2A B subunit isoform B'-alpha; PP2A B subunit isoform B56-alpha; PP2A B subunit isoform PR61-alpha; PR61alpha; PP2A B subunit isoform R5-alpha
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
PPP2R5A
|
||||
Gene ID | |||||
Location |
chr1:212285410-212361853[+]
|
||||
Sequence |
MSSSSPPAGAASAAISASEKVDGFTRKSVRKAQRQKRSQGSSQFRSQGSQAELHPLPQLK
DATSNEQQELFCQKLQQCCILFDFMDSVSDLKSKEIKRATLNELVEYVSTNRGVIVESAY SDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASWPHIQLVYEFFLRFLESPDFQPSIA KRYIDQKFVQQLLELFDSEDPRERDFLKTVLHRIYGKFLGLRAFIRKQINNIFLRFIYET EHFNGVAELLEILGSIINGFALPLKAEHKQFLMKVLIPMHTAKGLALFHAQLAYCVVQFL EKDTTLTEPVIRGLLKFWPKTCSQKEVMFLGEIEEILDVIEPTQFKKIEEPLFKQISKCV SSSHFQVAERALYFWNNEYILSLIEENIDKILPIMFASLYKISKEHWNPTIVALVYNVLK TLMEMNGKLFDDLTSSYKAERQREKKKELEREELWKKLEELKLKKALEKQNSAYNMHSIL SNTSAE Click to Show/Hide
|
||||
Function |
The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Oral cancer | [1] | |||
Resistant Disease | Oral cancer [ICD-11: 2B6E.1] | |||
Resistant Drug | Cisplatin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | PPP2R5A/Wnt signaling pathway | Regulation | hsa04310 | |
In Vitro Model | Tca8113 cells | Tongue | Homo sapiens (Human) | CVCL_6851 |
CAL27 cells | Oral | Homo sapiens (Human) | CVCL_1107 | |
SCC25 cells | Oral | Homo sapiens (Human) | CVCL_1682 | |
SCC9 cells | Tongue | Homo sapiens (Human) | CVCL_1685 | |
MDA-1386Ln cells | Tongue | Homo sapiens (Human) | CVCL_H541 | |
SCC15 cells | Tongue | Homo sapiens (Human) | CVCL_1681 | |
UM1 cells | Tongue | Homo sapiens (Human) | CVCL_VH00 | |
UM2 cells | Tongue | Homo sapiens (Human) | CVCL_VH01 | |
Experiment for Molecule Alteration |
qRT-PCR; Western blot analysis; Dual luciferase reporter assay | |||
Experiment for Drug Resistance |
CCK8 assay | |||
Mechanism Description | microRNA-218 promotes cisplatin resistance in oral cancer via the PPP2R5A/Wnt signaling pathway. Suppression of miR218 or PPP2R5A significantly promoted or reduced cisplatin-induced apoptosis, respectively. PPP2R5A overexpression or beta-catenin knockdown inhibited miR218-mediated Wnt activation and partially restored cell sensitivity. |
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Oral tissue | |
The Specified Disease | Oral squamous cell carcinoma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.94E-07; Fold-change: -4.07E-01; Z-score: -1.25E+00 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.73E-16; Fold-change: -3.87E-01; Z-score: -1.29E+00 | |
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
![]() |
||
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.