General Information of the Molecule (ID: Mol02125)
Name
Oxygen-insensitive NAD(P)H nitroreductase (NFSB) ,Escherichia coli
Synonyms
Oxygen-insensitive NAD(P)H nitroreductase (EC 1.-.-.-) (Dihydropteridine reductase) (EC 1.5.1.34) (FMN-dependent nitroreductase); nfsB; dprA; nfnB; nfsI; ntr; b0578; JW0567
    Click to Show/Hide
Molecule Type
Protein
Gene Name
nfsB
Gene ID
945778
Sequence
MDIISVALKRHSTKAFDASKKLTPEQAEQIKTLLQYSPSSTNSQPWHFIVASTEEGKARV
AKSAAGNYVFNERKMLDASHVVVFCAKTAMDDVWLKLVVDQEDADGRFATPEAKAANDKG
RKFFADMHRKDLHDDAEWMAKQVYLNVGNFLLGVAALGLDAVPIEGFDAAILDAEFGLKE
KGYTSLVVVPVGHHSVEDFNATLPKSRLPQNITLTEV
    Click to Show/Hide
Function
Reduction of a variety of nitroaromatic compounds using NADH (and to lesser extent NADPH) as source of reducing equivalents; two electrons are transferred. Capable of reducing nitrofurazone, quinones and the anti-tumor agent CB1954 (5-(aziridin-1-yl)-2,4-dinitrobenzamide). The reduction of CB1954 results in the generation of cytotoxic species.
    Click to Show/Hide
Uniprot ID
NFSB_ECOLI
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: 91347
Family: Enterobacteriaceae
Genus: Escherichia
Species: Escherichia coli
Type(s) of Resistant Mechanism of This Molecule
  DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Nitrofurazone
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Escherichia coli infection [1]
Resistant Disease Escherichia coli infection [ICD-11: 1A03.0]
Resistant Drug Nitrofurazone
Molecule Alteration Expression
Down-regulation
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model THP1 cells Pleural effusion Homo sapiens (Human) CVCL_0006
Mechanism Description Escherichia coli contains at least two enzymes which reduce nitrofurazone and other nitrofuran derivatives. One of these enzymes is lacking in some nitrofurazone-resistant mutant strains. We now report that there are three separable nitrofuran reductases in this organism: reductase I (mol. wt. approximately 50 000, insensitive to O2), reductase IIa (mol. wt. approximately 120 000, inhibited by oxygen), reductase IIb (mol. wt. approximately 700 000, inhibited by O2). Unstable metabolites formed during the reduction of nitrofurazone by preparations containing reductases IIa and IIb produce breaks in DNA in vitro. In vivo experiments with nitrofurazone-resistant strains, which lack reductase II but contain reductases IIa and IIb, demonstrated that lethality, mutation, and DNA breakage are all greatly increased when cultures are incubated under anaerobic conditions, i.e., conditions such that reductase II is active. These results provide further evidence for the importance of reductive activation of nitrofurazone.
References
Ref 1 Nitrofurazone-reducing enzymes in E. coli and their role in drug activation in vivo .Can J Microbiol. 1975 Oct;21(10):1484-91. doi: 10.1139/m75-220. 10.1139/m75-220

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.