Molecule Information

General Information of the Molecule (ID: Mol02090)

• Name: G2-specific protein kinase (NIMA) ,Bacteroides fragilis
• Synonyms: NIMA
• Molecule Type: Protein
• Gene Name: NIMA
• Sequence:
  MVESLVYLVLHTRLAGRILLCQPKHSGTLLDLIGQNTGFTEDNDTPEIGCKLGRNYPVLL
  HHTKRDFGMLPDGIHLMPLHGTVKINLPVGIHIAHGDGIRISVIAMKGKRTAGHALQYRQ
  AFFGRQQLAFAPHFSEHHISFI
• Uniprot ID: A0A097IY62_BACFG

Kingdom: N.A.
Phylum: Bacteroidetes
Class: Bacteroidia
Order: 171549
Family: Bacteroidaceae
Genus: Bacteroides
Species: Bacteroides fragilis

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Metronidazole

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Escherichia coli infection [1]

• Resistant Disease: Escherichia coli infection [ICD-11: 1A03.0]
• Resistant Drug: Metronidazole
• Molecule Alteration: Expression; Acquired
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: THP1 cells; Pleural effusion; Homo sapiens (Human); CVCL_0006
• Mechanism Description: In B. fragilis, nimA encodes a 5-nitroimidazole reductase reducing the metronidazole analogue dimetronidazole (1,2-dimethyl-5-nitroimidazole) to the amino derivative, preventing ring fission and associated toxicity. The role of nim genes in metronidazole resistance is controversial. It has been established that overexpression of a NimA homologue from B. fragilis induces a 3-fold increase in metronidazole resistance in E. coli.

Disease Class: Bacillus clausii infection [1]

• Resistant Disease: Bacillus clausii infection [ICD-11: 1C4Y.1]
• Resistant Drug: Metronidazole
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Vero cells; Kidney; Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus); CVCL_0059
• Mechanism Description: In B. fragilis, nimA encodes a 5-nitroimidazole reductase reducing the metronidazole analogue dimetronidazole (1,2-dimethyl-5-nitroimidazole) to the amino derivative, preventing ring fission and associated toxicity. The role of nim genes in metronidazole resistance is controversial. It has been established that overexpression of a NimA homologue from B. fragilis induces a 3-fold increase in metronidazole resistance in E. coli.

References

• Ref 1: Metronidazole: an update on metabolism, structure-cytotoxicity and resistance mechanisms .J Antimicrob Chemother. 2018 Feb 1;73(2):265-279. doi: 10.1093/jac/dkx351. 10.1093/jac/dkx351