Molecule Information
General Information of the Molecule (ID: Mol02089)
Name |
Aquaporin 2 (AQP2)
,Trypanosoma
|
||||
---|---|---|---|---|---|
Synonyms |
AQP2
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
AQP2
|
||||
Sequence |
MQSQPDNVAYPMELQAVNKDGTVEVRVQGNDDSSNRKHEVAEAQEEVPGGINFWAPRELR
LNYRDYMGELLGTFVLLFMGNGVVATVIIDGKLGFLSITLGWGIAVTMALYVSLGISSGH LNPAVTVGNAVFGDFPWRKVPGYIAAQMLGAFLGAACAYGVFADLLKAHGGGELIAFGEK GIAWVFAMYPAEGNGIFYPIFAELISTAVLLLCVCGIFDPNNSPAKGYETVAIGALVFVM VNNFGLASPLAMNPSLDFGPRVFGAILLGGEVFSHANYYFWVPLVVPFFGAILGLFLYKY FLPH Click to Show/Hide
|
||||
Uniprot ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
IDUE: Irregularity in Drug Uptake and Drug Efflux
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Melarsoprol
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Irregularity in Drug Uptake and Drug Efflux (IDUE) | ||||
Disease Class: African trypanosomiasis | [1] | |||
Resistant Disease | African trypanosomiasis [ICD-11: 1F51.0] | |||
Resistant Drug | Melarsoprol | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | African trypanosomiasis strain | . | ||
Mechanism Description | The laboratory studies above showed that uptake of both melarsoprol and pentamidine by trypanosomes is under the control of both the P2 adenosine transporter and AQP2. These studies were extended to additional T. b. brucei, T. b. gambiense, and T. b. rhodesiense cross-resistant laboratory-selected strains, which all revealed either chimeric AQP2/3 genes or complete loss of AQP2. |
Pentamidine
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Irregularity in Drug Uptake and Drug Efflux (IDUE) | ||||
Disease Class: African trypanosomiasis | [1] | |||
Resistant Disease | African trypanosomiasis [ICD-11: 1F51.0] | |||
Resistant Drug | Pentamidine | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | African trypanosomiasis strain | . | ||
Mechanism Description | The laboratory studies above showed that uptake of both melarsoprol and pentamidine by trypanosomes is under the control of both the P2 adenosine transporter and AQP2. These studies were extended to additional T. b. brucei, T. b. gambiense, and T. b. rhodesiense cross-resistant laboratory-selected strains, which all revealed either chimeric AQP2/3 genes or complete loss of AQP2. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.